The_May_Flow-neous_WritingsNYNYBOOKMOBI#<(-2_6z:@E K Q| W1 ] bhnwtRy~lztp(T `!l"L#y$]%&'*()*+, z-./0 1%2*30b455;J6@7E8J9O:T;Y<_=ed>k?q @vA|BC DEFGBHIWJKLXMNOP*QRܖS1TUVoWTXYZ [\]G^ _&`,Qa2-b7c=XdBxeGfM(gRVhWi]2jbkh'lmmrnxo}pqrHstuvwpxydz8{w|Ä}~cߘYc y!'i-k28~>dD7INT6Y_eekUpv| Js?HD`5>E !S'K-A328>CH6MRX^^dnjTp9u{QU*7"ěGzw8 j$P)/?4:[@EKQ0V\bFgmsex~=4_oma -  ݢ   >q   &?+17=kCdI4N S!X"^$#c$i%n&s'y:(~)Z*+,$-./012c345Ŕ67889ۇ:; <Z=>?3@AB pCFDEF$~G*!H/qI4J9K?LDMJNOOU'PZQ`ReSkTpUvV{WNXYZ*[\]Z^b_`abcdeχfg\h6ijklmneop qrst"u(}v.w3x8y>zD{I|O}U0~Z`fJlqw}rx"`Jƒ#ӺZ4| s     3 # ) / 5 : @ F Lo R W ] c h nm s x ~w l    U   {   ?   q  Z   O   m         &Y + 1 6> ; @ E KM Pr V \ a> fl l q8 v {z %     H S      7  ͩ ө ٔ A   z  x     D   $ * 0a 5 ; A G9 M R X ] cT i nc s yh =    t ,    6  7  m L ѻ S  Y ! $" n# $ % & j' *( ) w* + %, *- /. 5W/ :0 @1 E2 K3 P4 VZ5 [6 a7 f8 l9 r: xL; ~< = !> ? @ A B C D E _F G H ǪI ͆J ӅK ZL M N !O P Q R S T U V MW VX %+Y + Z 0[ 6g\ <] A^ Gy_ L` Ra Xb ^c dd jHe of tg zPh i j k %l tm n Ko p q r Js t Eu v ̉w x "y z { | \} ~   Od!r&+^05:>CHJ{J|JJ(MOBIQx) PEXTHdBT01SPH,4    )The May Flower and Miscellaneous Writings
By߯߮糯">HarrieteechStWWWWW[ϺϸϸϸϹ?Ǽǻǻmbp:pagebreak/rlear="all"/(׾W//WOO>INTRODUCTION.___׿׿׿׿׌????o'''''owwwtMr...merson,nisateeportolegisurefG'''7assachusettsnrtreesshrubf0aHt,Pdescribe_gg77'߻777ggg摒׾׾׾"OftenromeneathJedgnowankᕨseprising߬G'Ggg/.fragrant,ly-whiorose-colored搚\(aiest'WWwvharb@spr`?OOOOOOOOooOOOOOOOWWWWItboundsѕsfheoodsboutlym@h,slsewherepnd mustaveeen*firfloweroalutestorm-beat`crew̆Mayo{conclusix3irterriblin`.Ԁdescendants# nceiouslyerivednamlthough遘blooms~ofpassbeforcoming"."OOOOOOOOOOooONǞǝNocouXbeIappropriselectemPmk8by??????????_??WRdPuritanssragrx) Pceful,h7Ϫ">inva8bduct-harȆ#morockoilsemsرGGGGGGGGGGggG_rawe@realautycolorwthqperfumeaȤPO׷׷׷׷׷׷׷׷׷׸׷">a@thplowhic3rootletakeMearth.t____________aqѠfoulq|mattQanilodgwith??????????__?>scarc9anyiceptb9rsupport.ǾǽGoooooooooooomWhattP‰faxkhoppiety,our//fRs X̶drQXarrenPse{HwGGGGGGGGGGggGF lifضcqheavXҥB?ϾϽ_T8MFloaPJPyiselechXhowati!ariesNewnglsketches.ԟqworkadGGGGGGGGGGggGFcomparativzmdirculonKisowirouty8nGGGGGGGGGggGG>IȿicHeepublishednheresentolume,ithr miscellaneousritingshhichaveromimeoCappearR___________^differperiodicals.heyKbeent@(alloodx#he׌׌׌׌׌׌׌׌׌׍׌gayesthgrXst--y onnected,yaseIo??????????_??8emoryfpiendsnd nes @d.ϘϘϘϘϘϘϘϘϘϙϘΝ''''''''''GG'&thoseowa8!througorwhohreberףǣsocialiaparti@CincinnatiorYgenmeekof??????????__?>ȆAclwed.ׯї2actioerancǰǰǰǰǰǰǰǰǰDZǰ">au`r9t(byeurvivؓAemicolon___________׼׻Andover,pril, 1855__________WwWWmbp:pagebreak/>
CONTENTS߿׿׿׿׿׿׿׿׿׿׿׿׿׽ǽǽǽǽǽǽǽǽǽǾǸ7UNCLEOT׼׼׼׼׼׼׼׼׼׽עϺLOVE susAWǽ??????????_??=THEEAOSEooooooooooo׿ǿǿǿǿǿǿǿǿǿǿǿǿljRIALSFOUSEKEEPER??????????__????????????_??ITTEDWARD COILLIAM߳߳߳߳߳߳߳߳߳ߴ߳ߝEISTRATIONOUREPARTEDIENDSxEWEAR'SҔ''''''''''GG''}MRS.PbB.;R,HATө THINKSBOUTTgggggggggggHRMASGOOAI׼''?''THCAREHEAVENDISCIPL`??wwwwwwwwwwwwwWNSN ON7?????????????=HOWOENOW?GGGGGGGGGGGGGEWHICHSLIBERALANǹǹǹǹǹǾǹǺǹǾ??ELDER'SEAST.--ARADIFAODICEAwwwwwwsntize="3"acHCalibri"> ARTNDwwwwwwwwwww'CHILDRENGGGGGGGGGGggG'HOWOAKERIENDSITHMMOϼϼϼϼϼϼϼϼϼϽϸwpENEJERUSALEMoooooooooooGGGGGGGGGGg3"ace="Bookmanldtyle">THELDEETINGOUSE.--SKETCHROM !NOTEOOKFNGENTLEMAN THEAYLOWER.xi`strongartsdeedsnoordsw/fuitloweritenpok8against,Йways ppecte`"tchP oPshoPnations@׾׾׾׾׾׾׾׾׾׿׾֒h9 thyunlo.󹧹繧ǺǹNow,uiseryroicpophe,ouayup0hatavO''some8xGcitell.y` ans.t mereaittl߽߽߽߽߽߽߽߽߾߽inductobreez0fatriotism,hcccasظYusX߾߽'mind,`)on remembr)alleverovedr cherishinheanfurarly8s; ifhouseemoerodomadeanyeopleorartsyth,etmnlyimaginQaidbout "aKentuck,EngQ,p*ړǓǓǓǓǓǓǓǓǓǔǓorn4worwhichAyappenb,*will??????????__?>fituiteational.OOOOOOOOOOooONǤǣButPsuchingbstory,iimbe.ėyou+I''''''''''GG'&littvageNewbuznau?ar1ndid;氿߱߰>0wjustthosȝ(plsenobody[cam?????????__??unlesɄٯ@urp:reen Dhollow,dgxlikebird's׽׽׽׽׽׽׽׽׽׾׽nebetwhalf@dozi(lls,atepdY)׽׽׽׽׽׽׽׽׽׾׽ֶ(s;o1rʡstraitlyuiPri׽׽׽׽׽׽׽׽׾׽קixwtPBQ.Ըinhabitantpiall𽗽Rrespectabopsdfa0famihwhoahaoi,bred,`rriIdie0YuTselfsspotjy(useIπpeophlivCm;ǺǺǺǺǺǺǺǺǺǻǺƿ}m0#sick,ri te1we0.ϻϺAnatswt@ou9growy׻׺stoo!XlPfrompPwaooǻǺunchangepybɬqexternalsxewPy.Ȇy

house,ndhereasrown cross!y4yellow<ˆwwwwwwwwwwwv;wtstragglingailencerHtribXfulleinooߌߌߌߌߌߌߌߍߌstalksetween.ԋministerivedXr'SquiMoses,ooooooooon1Deaconart,undhillcMessrs.adabAbihues''Cbyҙ#road`"widHcmith4meetEbenezCampepthoemaker'sap onedߠߧOOOOOOOOooONPatilymininrx/8GG׮׭ComfoScran,hostoحKholeP saax@eadsϭǴ77777777WW77braimbles,cori bafancy(`chief everٮelse__ϺϺϺϺϺϺϺϻϺyou`k.ȭjtoo(Ygralost(fqAϺϺϺϺϺϺϺϺϺϻϺm)eeetarvushf0edctw gBpward?ϺϺϺϺϺϺϺϺϻϺϺmp)a$upcrib om fDollyorǻǺDŽZ)8enam8not j.77ooooooooooonFresto@nmoPrtscpeopxin//NewbualwayseirPi!hro'clock!afHnoonW?????????__??cbeark+ porkZminut`suWWWWWWWWWwwWWQdnaturdayنmeetIQun@;GGGGGGGGGGggGchooluse0Qordinahinconven;hnborly//////////OO/.charitySeachクr;К;Bi谰fearGopGGGheight="13">
cXepwithuchhingssPeyad--Pesthilosophy,fterll.<ֆ>SwlntohiMasJames‡onade irruptiin//year eenundreddotAwhat.ow,s$Hbeourhroȅhju)oensa--ate,oou''wouhhaveou,f)љinewburyweekHgggggggfarrival.?9ionefshole-hted,nergeticankees,hoi ornaturyIcorkon覸.ȡosseXgresharcpacxisI@alraiPo0ppihdenomied//////OO/."cuP,{signifiabilit8oxveou(ry779knowrnXmakeoup'G'''''''''GG''oranؓnXreopleJeirledge.Դqu''>/gxZielicanimspiritsuoyantߺߺߺߺߺߺߺߺߺ߻ߺcheerful1PB,u|ŇQ&per؋yany(eelsexotrdr9regardɵ''''''''''GG'&0InguisBs.ϹϹϹϹϹϹϿGϹϺϹξ''''''''''GG'&Asps¶purroXePvezmuHsa//t--halfJgirlsbu|tecao߽߽߽߽߽߽߽߽߽߾߽remarkeirstabba eh tmee sڞPYauc8kucФɯAroguHeyѽWWWWWWRontize="3"acHCalibri">jovityndrankishnessfemeanor,hatasonderfully knowledgrejoichem%nstlDonyYWWWWWWWϺWWwwWVelxcams LQastonishgggggggggggxdPs`adeb.߿߿߿߿߿߿߿߿߿߿߿߿߿޽ǾǽMXJXsttiȱ@tsio۪Newbury,11yearge;h)ficusahichfont>

predominatednimost,heoyrZ.ԀeliefatXould,Heiguhschoolm0hɟ00Sundays//߮߭*au@@ng1d hnssidetudyL7GGGGGGGGggGGGrIrin,obodynewhen;uxit(g8PgeOOߺߺߺߺߺߺߺ߻ߺwhilemSdo9yblx't׻׺JamPerstoodlarcraftQpopularmadximselfoia0xmney`rnpYregrobout;:geogh×A'h@arrelpp`bin,lpon蝹ref@axntifulness;joic">g"isife,evouro@les'nutsQpumpkp0mostlat(ppetiteYquxhoishthPc(9way____________??Tdegreeڻsa` acquirnwhruhwo0.eGGGGGGGGGCan>knewllboutrithmeticndistory,j7catchingquirrels iniquأcu9patu#gsaww size="3"acHBookmanldtyle">determinatelyveryittleeartasoilingithischiefnd communicQselocharg qreonone (skg7sprwill)anu8to#j;ߠimpulswardtudy)goldegood-hur dhofOoonJamesenttim;xw fr`afXm.筗?__^Buph "oolout, 0spirpodӹPڌ0yG׸׸׸׸׸׾'׸׹GGGtumblpsodabjump#benchXburg_____________">doorIuchapɫ]ieЦɿomyGGGGGGGGGGGGGGTyoup󸉝XepphomeĬfelicitouϿOOOOOOOOOOOOOexpressTntenancocظ:hڹdrough?????????????>fep0urrantsРiH:alowGGGGGGGGGGGGGFi бbackhelpixaemptyrɌubjsto_____________o𽈟devoiAԟ8Mistat,rweknewoooooooooooooimportQp٧1Xbeialwaysept*sunny`dod,(WWWWWWWWWwwWWϾϽW h8ons'seneralXi0thXwhi`eundry and ifold;oradusthkindlyaratellnoveitheveryingfemininehapecamehisay, !ifnot''beenlessedbpqualilityBalloutgain,eoqnoww!AouPha8becoo8im.†AtengtopbidYcaptivhtt quitixšshJ,ɕ8ooooooooooondevot@thusuch coRillrationQouqro,fwes9s蠮behal;9,re8e m(ooooooooooooegreader'stenzwhilhrawiagram tww߳߳߳߳߳߳߳߳߳ߴ߳ssi iadeazer.߽߽߽߽߽߽߽߽߽߾߽Doouee@nrowousiitsroslop*lmo½grouh a痠t,nsuppor0,uonnetaiazzahooto9frdoor?َ)ȞP[icpit; ׽׽׽׽׽׽׽׽׽׾׽ֽRntall(sweep,lixilearysky,obserړ(dHbolstersg^fchamber//windows at(mmmorcollecgatpsw0//!aIOt;try,츠littl??slabsl8upfore@poles.Zreme7777777777W770zephy("holaymo:xbrushshakezlassel$tchowlnysstoiveight="13"> performpmilarlirtationsithhepiderat`abbagesateregooseberbush(rollupZfence,nterssBrwoooߙߙߙߙߙߙߚߙߙqui`reeoffnrnerjylittppatch,??enuriousdevotXto ament,0ichЀxlmarigolds,oppies77ǧǦsnap,cour-o'clocks74abox!itselfڦǦǦǭ7777777WW76qr(niumiseeٍlrou(gardxmucWWdzdzdzdzdzdzǴdzlikestarhancmas0qaankeehxe.׳׳׺GGGGGGGggGF///Ti dwell1ofnchLotrisw.`s`ѾcommocaA,adcharactaa8ouskeȑtlacrZQsymmetry.ȥcXtnutrr߾abQa"(opsubstantialoodnes3in1ǿǾong-grȸxpyi(Xnse,┠culaworldwisdomf`cla(peoppNewngl ;њ؆ooinqheart;tllataɇ wcpsaepsurly׿׾petncaphalfyetwejo1`Hcolor`every@׿׾zai@8did7777777777WW777777777777WW76Ifoukavxof Uncleot,eenerallyeptourguingalfn hour,orovehareneededandAtellZxcouldnot XehibroublPwith(lpyonodyro`Ѝ''chimeJmbserphimHgularpmak"isheparations蓇grarquessee,yddlimmerfeywas//[(lehear "couspomatt+ichߠߠߠߠߠߠߠߠߠߡߓas, W,--I獸sH'Pgo,8jhu'sposeut~least;so@!`*workԢ!day쁰ed$hen8n777777777WW77upahreAxhort4ɯHpain'ٜbnbor״ߴߴߴߴߴߴߴߴߵߴwIo0!out.I f F'sreinz,way8W2m[yldn'׻߼߻a'亁so;it"stgy dorense??????????__?>clٴslaZdiligentGGGGGGGGGGggGGصXirfficultiegroanᕨspiripmean,7777777777WW7folkxbmakeeop8@much.''''''''''GG'&~S,Hrntsknowfwilephimhoo-x,sittboy8akqYcros!cornfield?׽׼?Whyy\uowny?Galibri">"Ourssroke. withisoesextime."dauer;heormerxurtoryegins,asaOOOOnIboringiahtitution.yprecisehvs//////OO/.easyontrea0skindhin ernalherlpmX*ooooפףr)se.ӓP!onfoseespectablpla!ladi8whomouGGGGGGggGFmtenaveenZwachurchaundaequippB?ϰϰϰϰϰϱϰg9psalmCcarry!sodrirangeeel`GGGGGGggGG>stalkfennel,ygi@ychildri1eereleepmeet.߽߽߽߽߽߾߽ޙ奱heerfuldpcyeaettthxsuby!kit0nirTslaloXam1߳nglhOOOOOOOǺOOooONuliaritI𒃒`nɹnphIborld;~1)sa8X9P(seemfMissrX,_xondauerGGGGGGGGGGGGG77Prҡ8rsPܶs@ndow=natмelf-possessiDadxsl0taiwill'fown,etood-humor4a KnrP׼׼׼׼׼׼׼׼׼׽׼favoxe.tuRpuzzliPladodhtIhow who׼׼׼׼׼׼׼׼׼׽׼֯_outqNewbur~lif knewaspeakact, andehave,nllccasions,xactlysfheaenau0ow.hewpjustefhoseiflowershichouayometimeseHaving??itsittleiPwood lHivildgarden-likeϔϓthatwonderiteyid㌐p#rowreyature7777777777W77adept9househoXconcerq[)homazprettyqnerg0cyblaboutC"putt//////////O//sos.K̘oXYankdamselȧ]ang:ftPȭGrknowledg ,(ha@`eraryountainsagggggggggggfdistricchool3feѧا!wsoevca0.ruG>utT;aperhdownϻϺx٬ono(asonAinformati )alwith!ǻǺwoufeelsta{QpleasHfi\@muchmocs벰p9!ѭpec.gggggggϺgggf߿߾UncLolYnlshtmagical Xnes(׾׾׾׾׾׾׾׾׾׿תa 8Zwasel)aisem⸰iscern@by׿׾ ten!occasmark3{didn'Xwhyboy7neyoaɽti8a'8min'2GrXor:nsoϿϾextror'nary`xr.boQȔs|PXto8ϿϾgeneryWwnwhi1sco@9givepith aegularoodrhhatasuitereditable.ׅׅׅׅׅׅׅׅׅ׆ׅ֊//////////OO/."Father,kaysNJy, Itoaveartyexheek.;GGGGGGGGGGgGGYouha'n't\in'ouries,.lw9ebits''ndndsxfortnfterSon Ioْio8soǢǢǢǢǢǢǢǢǢǣǢUncleoAlkedut+AuSallyMisDroceedh makeGGGGGGGGGGggGFㄘBp0yH1ϮWhen _cameomxsaw(longrrayfӘrowsonkitcḷ/--?I!hillXHelummery?gggggggggggggWhy,i@,xr,said,ithXgood-naturlțooooooooooooonconsciousness߽wwwwwwwwwww//tribesxosour;utvisageg@waxomicalࠡX`dauheso떨nong,1//quietlytowdinnerw''ϺϺϺϺϺϺϺϺϺϻϱwrFץױaf, w@hwatwoocandlXicks߼߼߼߼߼߼߼߼߼߽߼nexteek." draw)hQdlestick,evellitwWWWWWW׿׻WWwWWWW;Tr_ckO?OwwwwwwwwwwwwO;Bu(]Ianttwoggggggggggggggggggggggggggggg;Why, 't akene?OOOOOOOOOOOOOOOOOOOOOOOOOOOONo;must8ve//׼׼׼׼׼׼׼׼׼׽"3"ace="Bookmanldtyle">"Well,hen2re's'oY;nd aol-de-rolXrouoie gnnpraisveHBflintϻϻϻϻϻϻϻϻϻϼϻagȪX--nlaudabfear fPowګiultitude.Ƞ@reȰydeonscien( utly ay9Hthç@`砏aid behalfhich,ᮋgh(vA(Ӣ y,0eque(opportunitiooSIǷ1ceP(dliku8erop߽߽߽߽߽߽߽߽߽߾߽much#, ,csXbouHellǽǽǽǽǽǽǽǽǽǾǽen!Ymaupit.ert` (yremark0yppG׽׽׽׽׽׽׽׽׾׽ףfindyHbe1acquted;ui怒er׽׽׽׽׽׽׽׽׽׾ntize="3"acHBookmanldtyle">asatterfourse,romngchool;hateolunteeredka s.ven(emerҚ:tmeetYhousefullory,ith'flutppsalm`okndzrm,ou8stopaskjxedid3iftɧ0weargarryfoot'wa(ome+,isup`sermon,2oyi( (syb@, "pQpleasast,rettiXyGGGGGGGGGgߺߺevy!e.ԭAon١ cryZi0@[eyeo''Uncleot.׵8,ecarnedplbytuiӚldec)pitchpipe,//ҧIsla`aget)pert@oXroduc@@itl.or i 7@f򴏻''good0o`ab)nxH'!Xenanеntowards󓗻'''''''''GG''neiȺbedim-Bny n means.ߺߺߺߺߺߺߺߺߺ߻ߺ޿77777777777776To wokispeechxon覐say/////////////LQidn'tkim;ڱt'ifxpWlorifʣʥ2rq$undayacZevwlibri">asfePmasterfll:didn'tiket,ndjoul."utur heron8hitownrscomfitedymalceaspecf'GGGGFUncleot.nqrary,eneportCWhpJamxsaiKxionchiefunselloȥKdoou"koooooooo////.Gr*s?Wwwwwwww7777WϮϮϮϮϮϴoϮϵWIXknowg`0proAabappearanhooooooo/////>ceinty.77oooooooooooo!ButcagetIf & rossboiマOOOOOOOOOOoOOt;Fudge!ɋakee)IavXi`tory߼ooooooooooooߺ77777777W77;W@enim,9'Ȋb(giupatlutarIмϼȚOOOOOOOOOOoOOGǾG;Fa,ol,a--ima@mytoog;Why,ow(o0?7׾׾׾׾׾׾׾׾׾׿׾׺/e="3"ace="Bookmanldtyle">"O,'llorkt,aidurero. <''Bookmanldtyle">James'soulaslwaysverflowingithhatindfoetryhich ~hisxetxnpscythe. "Muchbliged,aidames; 3butmnreaturry.Soying,x<~//////OO//>startedveryusiness-likeshionowardsheate.??????__?>ooooYou'detterestopminuÐ''''OOOOOOooOǛCan'ayייינǞ///WWWWWWWwWWWIoeehpossXesou ll2whileqsiak;ߤߤߤ߬''bodyouthink2had"c٤rhQers''''OOOOOOoOOǶ;Jumy@tu2,ncLot'%,wȵpeh/????gggggggg//t;Well, (any򹘿avraofix,jye?d,WWWWWWWWWWwwWVwhoasowuitengageohiswn0yIcasW'''''''''GG''WǻǻǻǻǻǻǻǻǼǻǚoundtonvenie`accepPinvitLahnytwicsood-natur葐if⾨firHXmatterOnfairlyrcinYpremiH,{ou0Jxgetپlopwalkexcesfusin`,speciXyabouimomAunt'''''''''''''&SSPMiXGr0enfromPfnoonll.ouye`_YQla0stabladil1orind߼ibri">Uncleotndasterameste--9,vaitchofider; when,heynpedur@roedpithomethingaGGGGGGGGmischievousir,issr8,narticulawxsouzzlthatth׌׌׌׌׌׌ג/דOOOONleHquKh tontieQonnetrs.utoooooooǓostaiactegreeabperfection.irst,xuneedsoGggggfdown@Igardenf'sonfulabbagesKnߠer(nadallrouCorQ,HoppIeHyewto>xappearancegratific0oifhadخh''''Ge@suchhisifeexaminOsvorite////////@expressHٙpst.'''''''''GG'&~"I!sbr8orthavpIhimselgainpfeposiSwdĒW ?ϾϾϾϾϾϾϾϾϾϿϑzaellflower,r0thin'oHr,|s(ߜOGGGGGGGGGggGOJWhy,e䉨youet? $pw[*s*ourro,~"yeyes illix(Xɮ9ooooooooooǽǽǽǽǽǽǽǽǽǾǽƼ>ullup@lktwojeeds,LrewymiȽ߾߽,uohoayaanyaboumatP;9__________Bookmanldtyle">theneamepndtoodyʀs. whichur`ro㠈inuhiddressesUncleot.ɟometi0oagggggggggggg0 owardsak!peopliktaXpforyndol;Juponprincioceeded.ț8alked,aughHo`riesjo`:mofearl,ccasionall'??sedawoɻXlh e,{aun׽׼oullf0ohwouhav0el2nydriftprejudicinld2alhadneatccomplment,rptier-nPldomacyEurop(bYgfee H_gggggggggggi{bodfiQtes;ض",fegasxgggggggggggjx,1gene(lyn)np.װsicityhWWWWWWWWWwwWWatacsseeюorwatcȷirts7777777777WW76vsȺ#whichigaztwhsprGGGGGGGGGggGGha,"hido.Ӽ???;iveight="13"> Theoughxteriorndate kindnessfncleotereuite<Ȇ_________spirit-stirringtudy;zwheneaa`ver, H؇aGrappenedtoe8together`fr9doop0brokorth,--njnjǓ??wwwwwwwwv"Ieallyiyour8,{!SOOOOOOOooO7OOOǡ71Do?aiT.ߤOOOOOOOoOOߓYes, .ȣsomhimЬIˀ 8zbet havishtut.߰߰߷7777777W77777WellIhopi8ma,D,nconsciously''InstodslhedpttlshamedWgggggggggggJstooP(seei orXfeaanyore߼߻th80--ai ofednolways8ndQonO//////////O//)fionab(pol--so`lysweX,--//)I!nk@@AthoughubthȷI㾰getzXownϾϾϾϾϾϾϾϾϾϿϾi߼߻߻߻߻߻߿߻߼߻߷t;He馀ȟest`npatv pge; kɲcts ِ̦v> Jamesurnedittleway,ndthe `veningk0whichwaslow likhalm,oldenea;overt silnew______^moon ithnestaro膘c`forr.Ȇxhomeחחחחטח֒ dropsffromrosebushbwatchPseemingggggggyelljGr(ood (yuietlyXitɍBimpeak熇gain.ooooooooooooǭǭǭǭǮǭǭ",caid8htast, +Im1@collegisll.[OOOOOǵǴ?9Soou0meesterddSw߾߾߾߾߿߾߾߾߾߾߾߾߾߾߾߾߿߾߾ڤ1pdown'(eraniuпIbeg@8yselfʾpullњ0deadeaves,emarkihme,--ǾǾǾǾǾǾǾǾǾǿǦǼAifɑHtlik),i̼o?oϼ纇IKnow 8yell?o߻߻߻߻߻߻߿G߻߼߻߻߻߻߻߻߻߻߿߻߼߻߻߻Co_kqwhIZ ,HAadf lyp߻߻߻߻߻߻߻߻߻߼߻ަ1topapplreϼ缯Ͻϼ''''''''GG''Wwish,QnwouxunderstѐoutyWWWheight="13"> sayingnyoreboutt,"aidr.< ׆ׅ___//CO,oeu(Iill!durro,(up0theryintellige(air;dasuSallyou8heatterasGGGGettled,Snords^.[ϝϜWWW'Nowhearrate耨sawncleopproachߡߡߡߧdoor,adimpudencetakeHtisluteppart777toge؆xngKddjusttops[greatompoA?GGGGGGggG︟іfWPh,tAbest머peɹ翗aw;IemorcrittursȑGnishly.o׊declare!ɼXndyouanJames=foPHkyϾϽexceed-//////////O//SoHyP ԩomhӶ8*downng??flour__________׿׾_ZTheiwyAof"?in'sOOOOOOOOOOooONwithuchl 777777size="3"acHCalibri"> whytnotetter(hing."Why,es,Qmay8WW,Saidnclè butsɐalwayse8Gr8myferaiAriofnstrument,ooooooooooofall;solemn7ϜϜϜϜϜϜϜϜϜϝϜϗ7''''''''''G''7;SJ!/dames BaccordЖqyouork :ѦrnowǨ____________Ǭ׬So0yp YckpHundred;proceederoughiwithreatOOOOOOOOOOooONperseverance.//wggggggggggggwQTgh'''''''''GG'''''''''_''GG''$ ,2Iok8 is߼?????????__??>firslikeljneetpW׻WﺯϺW;Bye 0llyin) betternog緵,forWWWWWWWWWWwwWVy1Iould)pitchuneso/GG/_;Maybe 'ty1'uchwGGGGGGGGGGgGG߻߻߻߻߻߿߻߼߻߻Thoweverenough as9twhooonfdeparted,manldtyle">withislutenjpocket,ndrace'sastords5heart;
respondhaidd0Zhim???߾߾߾߾߾߾߾߾߾߿߾ߐB`I'mseemed0anǾWWWWWWWWWWwWWǼ7oXyan'8urmo'oors,I?oBhink @'ϽϽϽϽϽϽϽϽϽϾϽΫA whah=HW߼߼߼߼߼߼߼߼߼߽߼߼ښiasYbef@ tedself 8xime//with*mehgeneralvowa!run9inpiculaasOOOOOOOOOOooOforplyxsnt.ɍevidsicadXgunmelt,wwwwwwwwwwwwwv!mQPveenoissolv,zpllaty77777777777776incssis.WWWWWWWWWWwwWWVpan> IHoappenedhat,bout`isime,eorgeriswold,@enlynˆwwwwwwwwwwwqbeforeeferryo,htur@nativeillagafterving__όόόόόόόύόcomplet:heologicaltudiestibornstitution. isߌߓOOOOOOOOooONin8eHPmark2gradudevelopmeofind hearfromooߙߙߙߙߙߙߙߚߙޘٙrwhite-pdebashfuloyuitountry h_________olleHperiodenDsmhmaȢɠggצצצצצצצקצnoticeow%xrusȦprejcbegAclea gggggggggfhim--opinHlik8`hwri,assramplimdfschooljXconficharacicsichWѴfenBnwaϺre9abAtrik.ȅ2ndowby ithnmoncutene(of߻ߺfeelaٿ`dreflec--q8!sЇanǻǺr(erhiPbackwarung@|/////////OO/.WLleftewbuXο9AaciqappaPtlyooooooooooonph`icoy,nevincsensibi(y blushlXWWWWWWWWWWwwWgarXulstupefi`wevbodpoXP.acYfHGGGGGGGGGGggGFvͽ!ed,(re0mox9LlYhe;OOOOOOOOOOooONwhocehrunkromeyedea k reasiifGGGGGGGGGGgGG">metinis@,owvabout0gignitarlplWWWRt="13">
withllheomposurefuperioreing.< ׆ׅ___//ItasnlyoXegrettedat,hilemindmproved,physicalenergieseclinQaiveryisitqhisomeouhimaler,gggg77thin+lessreparinodyrsacf@ionchϞϝhadvo!self.utowHurister--aoWWW''>ݙ8R9Qst:ulpAach;waoy犯iglo@AuXSy1oncLoifzenoshamown777777WW76it!ǶǵOOOOTfirs ayf@!cPknHrRneHzGeorg׺ϺϺϺϺϺϿ_ϺϻϺGriswoHxojoXexpectϼϼϼϼϼϼϼϼϼϽϜ?udience.ߺߺߺߺߺߺߺߺߺ߻ߕ׿77777777777775AtirjingBpsalmpxQyou`seظ?????????????>8te-hmeطirttentivelward3;?????????????Jxiouxolittblackonnets,pooooooooooooon@himxse. 8Bqchildr l𔨆Icause ggggggggggggggboelЅYedYFpIrpew,s'''''''''''''&consideratadjust1AuSally, mypleasɼ߼߼߼߼߼߼߼߼߼߽߼moYouxy3Missr,ftAsweetJ׽׼nldtyle">brother,ikelowero un;Ireasurriendamesn9 fragallery,isoyousountenanc9little8uchedithoetyndexpectatio`short,Xmoembarrassinglt tivXudHhnever??greetfirstfff`nginister.ndyheseircumst!sϔϓ&somethXӀIervelf-xgetfulnesshich''''''''''GG'charac𜐍?8xercisPn--bveסנ/yneuhe.ǥǥǥǥǥǥǥǥǥǦǬ>??TdevoutoetfJprayQrOtpsmScripture,ױװ.loqu֪rstget nemog77bread r VmusicusB߾silϾϽ>beguilwtfee.ɪserm`ɫ|½intellual诸onٷ@ccurrⷙrgumѕ)teqduis`HNewnglcourse;⡸i(HYwwwwwwwwwwwvlifeyanshasubdued,K"out`.̠ P6suenl¨meltYtooooooooooonsam0o7777eculiaritiHoctrininvolvةy77allhiddenacfinmyits''relati`futuhprogressvtrydousrtaXi">oftsternaloodrll,eemedoaveweltnisind, annerervencylmost anororld;hilebexceeding'''''''''palenessɒacountenance;aremulousEvoica???>spr romodilyeak11uchIstroH@ky777777777aaticș0sf2besoarxabsorb۔t???IЙXAf`t.wwwwwwwתwwWhensreverXchregationispXYairgeopwhdXr9ٸhp2ll#ri ismgggggggǷggfoll`similao3o8Dea art--uHphrew׽׽׽׽׽׽׽׽׾׽׾H--"0lqmomehurchoo)gaze/ϽϽϽϽϽϽϽϽϾϽϪ*unw8xfee-ygr׻׺"He'shblhcre'!aid`{t``ctuya)8way778eyes; CIin'髰nФv*p0Hay. ?? Loю0miboutm4/AsohfrieJames,񯙯0firshobQ8eep0Pla absorbbyZdiscxseiHon`wmeet''''''''''GG'/vebeg02inkreyPXo nest s; m8I(lkomxy?OOOOOOOOOߴt aoqmZGeorgs@?????????????????zO,hdon'tYcat,f doXntrouble'$JamesIleavagained,@semlowpass2񿇿und(trees,our ȸloo(inquiryhichsuddimseahadXAou89supplyiAguiȯ*qu`ion promssoluٚnou0Zgonhinm(h?߻ߺ״өn9answxr(w70hasytoppedtUncLot'ateGGGGGGGgGGggGGGBWell,n,willou?"aidames,agerly. Leteo(h)with 0o-n|OOOOOOOOOOooONTheinistermiledssent,nepartsou0ofewhous,ߏߏߏߏߏߏߏߏߏߐߏthath9dr@outveneeingr.rom8tia''''''''''GG'&friendshipAmencbetwe ttwo,hichasautillustrationߝߜafftiВHopposites.tRlikX mornWWWWWWWWWWwwWV)--afreshnessunnenedeӁag@lei熗peAohr.OOOOOOOOOOoOOex5(yocinu(alth,fercy׹׹׹׹׹׹׹׹׹׺םfiwnelHQgravity-reaso8fHdGGGGGGGGGggGFplure驋buoyaȶIa ,nexhaظ8dϽ___________Plefel(imselfbermade)y,moonl //////////OO//ranqu0w|* marksuperioro??????????__?>erst`bqflu|C䪊s;p7777777777WW7caseith. Iasc hchRnewTcQover''''''''''GG'&Hlimidi(oa8nptowards solidagQ//developɭYcharacthPa8ourears'purjcollegeOPr`giousabitslikelywaysptalimpressionyp/////////OO/.fihLmpm{Iitaeculiarly?????????_[ce="Bookmanldtyle">happyne.healmness,psettledurposemidevotionfis //9effecznistrasyoungasto0؝ooooooooooattenBsubjІ2q1villagHwaarkeP(''a떑 asure)oweart.ut,ike9rexcitem@8t dsQexhaذ(notobeewvsensibly0lXdecxe]power"lifbe regulatewwwwwwwwwwڑsomethbirrquish9proC8wavencAlaboriprepar8k ߾߽W^farȌcrossai-cexpخfϽϽϽϽϽϽϽϽϽϾϽfri.08seorgej.eou@bЮlX am,׿׾hang worئafollowɴ)stepithyealmostWWWWWWWWWwwWVchildl --ArHose1le hxam8GGGGGGGGGggG_bou@upJuccessinkowi"cpஓirlage;0uuWhzturn`fromᇽfulfKh׺׺׺׺׺׺׺׺׺׻׺pain seeڋ ,vidػЕedۀanxxϺϺϺϺϺϺϺϺϺϻϚoncealtriumph`sw2seatmselfchaiqbeк׺׺׺׺׺׺׺׺׺׻׺ith, "George,hat 'areoctrinesatherfuzzler;utoueem to(ink'veoteunn't.houre'lyike knowooooooooooonbusssJhax؅bettЇBfolksboit;??andQoughjcavilostourageousall 'sWWWWWWWWWWwwWVexplanations,e{maerceivrJ(asnlyǙǙǙǙǙǙǙǙǙǚǙupliftedYhearxhboytalk.___________^פףIfengdrgumewit(ny(elshsity,7777777777WW76rXdwdown,쫘ing fromndQshaggyyebrow_ϱϰ me񋘝sHery@usualKhim.xpr''''''''''GG'ffeӌ@lgpleȀhalfoucg ثseǾǽwhicfodhard-favoree;b߾߽e0Pnpaibybevidpr@reg((fa9W׼׻"H1@io٫bod(e`e,{(, IwywillGGGGGGGGGGggGFdofie?{ϼϻ绯ϻn󏺎seserhh࿐r μ!stϻutumnorn,Astoodeag@stfencegggggggggggggbW1yyouPlemnizQ(,HdayP7qx@`dowalley'// height="13">

ofebilityntoonfirmedalady.eunkeryxst.uSally,ith<13/thxelf-deceit a d cheerfulart,houdayat "hedždždždžǍ______^woubetter,Uncleotesist0viction X`GGGGߓߓߓߓߔߓobstinateerQc)his8arac9hi莲ickneltCדדדךooooooo>had( unBvm.OOOOO杧?????__?>Jamesasw ouse,xhaugzAenergyѤϫϪinvenincaHfriendanneo seenm0GGGGGggGoursYrecklessn glee,scarcely1ognr߱׷">be!ppso@re࣡eyotchoiceGGGGGGgGGoucherglhmovharoXGbed.uss??quPmakai0buoyagladI,(t؁Cit׾׽[stBmoHsympaXticsorrowǼϼϼϼϼϼϼϼϼϽϼϺItnmorn ԖZroom.eorgȼ(bArQﻷ׻fishny;owardsQfeintoslY8umberwsbмsidlrholdibre z9wn_ihyetusk,kyr ebwi8olemow,߽߽߽߽߽߽߽߽߽߾߽޽)tabegin:disapp;,`ve:O߽߽߽߽߽߽߽߽߽߾߽߽ؠonthaleast,deth@gh߽߽߽߽߽߽߽߽߽߾߽߽casemikeye oureavenlyather,atchingvershen

allarthfriendshipsred.wwwwwwwwwwwvωωωωωωωωωϊωGeorgewokeithlacidxpressionfountenance,ndixhisGGGGGGGGGGggGFeyes 8ensky,ureaintly,--??wwwwwwwwwwww "Tsweet,mmortal 8 hedOItslu@s`d"spes. A(meXaftaahadeassh0 ; 8er___________a[qtsroppsilpillow'S!@ laxJambmǼǼǼǼǼǼǼǼǼǽǼǼǼǼǼǼǼǼǿǼǽNJIt'syris--iar--moY,_Ƚ$oooooooooooJesushristatchmso罟߻߻߻߻߻߻߻߻߼߻ߠ|O, Inow ;ope챸ownhiwXnworldntop.ut@amyx--bePehaveoneXy߿߾good.ۼ7DdooayO; k,8atou,fϾϽonlhme.olessouort!odilllesso; "follow*toavenAringehere.es,Ɇdo򆟆hau(.]gimyife,IsoulJwholetrength8''''''''''GG'&andn2not :ldnain.&quoגߗOOOOOOOOOooOOGeorg0miled, lxupward; hisȖthatfgel;/?JamHmth,0inu--ǤǣIt IlonhoPsayis;eخu;very q)߯߮ple|beࡪlas gemembranme??????????__?eartsrInowwggggggggggggw߾;BjGod!Ӗxid S.?ggggggggggggWeo, .$I seemedtruckithhealenessfeorge'sJ;ndomingojsidbed,`elt"pulse,laidhqanxiouslynqforeheaPl(ɒvoiceveralimes,nquir"ifdidn'tϔϓeelittHbetter.ߘߘߘߘߘߘߘߘߘߙߘޝ7777777777WW76sNo,hr,A;nak l ?in77ӤhesitateHmoment.FRgan,younow''''''''''GG'&thateusubmiRGodϰǰϴTheas thi*xprisDhichlashYh@inoP躈d.ȭproppsoٵ*aϻGGGGGGGGGggGGexclamatagonyturn9`ckllefeoom.'''_____________'!D!G@r2tryrpeXmدxetooTarm(h8bykitcwowǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿGetwachildh@ghlyǾϿϾǚr,ysreakfast x`dygggggggggggggggggggggggg;I䴨(a(any7,oð=shorbout. ;Salwhat?reouixin at 'eporrer?'OOJ height="13">

tZoqe hafo+ollowSabbPatq9sentϰ'''''''''GG'&,1hastxmbPson.e ersaw˫϶϶">e.ԫ)amilyಕrGPJamesideyBϽGGGGGGGGGggGGbvadyon\"otpa f,iЀɬ8d_a8n,ՙ)s9xe1l5age׿׿׿׿׿׿׿׿׿׿׿׿׫i`+Z1Bla0penemMBwalk׿׿׿׿׿׿׿׿׿׿׿׿>,bPstoo`Qkgazednoworenlifcimm@8ty/` 8eyes;8WWWWWWWWWwwWVC-pu h.Imladourg׿׿׿׿׿׿׿׿׿׿׿׿׮,TsaihsOeorgp,on't!;im!ɻǻǻǻǻǻǻǻǻǻǼǻkX;ɼ8vri-_ca,MǼǻio;Ĵfrخ@|Ybudpyroom׼׻o ;[nXyeemY(!AtHs?nt>

theonepeated,nweet,utterrupoice,hoseordsf 'llear'fulndtiddy."wwwwwwwwwwwvωωωωωωωωωϊωJamesnewheartooetoefusevornhichrpooldOOOOOOOOOOooON'siwasomfortingtself.ȇ0adr-hobstainǖǖǖǖǖǖǖǖǖǗǖfromXyxtraordinarqpressionsfratitude,ukx0ly,sWWWWWWWWWWwwWVaattefurse.GGGGGGGGGGggGצDr,;Xidher,lastvenIbeYeftom#IOmhanged;hothaleincefireaЁHer; now//////////OO/.I goiȴ`gonloi9:sure-WWWWWWWWWWwWW羯ϾPstopphrrqisXouxs߾ϿϾϿϾߡYes,ouyqqahothȊqatJwisonǾǾǾǾǾǾǾǾǾǿǾcannot' ooooooooooo7777777777WW7TkJames;n,okfulladdedGolpWWWWWWWWWWwwWVme.Pbeliha8mienwIe@to; hrRor3shiImyellow-men;brrbrbnHnrejoio!@'OOOOOOOOOOoOO'_Odoesowonless⟍In't v> knowhatouhaveecomefsfoudotenhre." "Ihoughtouounoteepwayromsong,aide,ithe Accordingly,heollowhundupSallyxUncleoty minister'sireside,eleditnessesfThanksgivpentswhichlleopwereourQin;nextayadncwmoГQ8asu8PseeaonirsȔsacrdesk,heaer atveryodyias "bestCYgached;{ritsoemarkediHthІ:tXwwwwwwwߠwcommapȦamesdiscP,HQevpȦOoooongopoPrfection.o_______ǰ_曓ThXpaeal2worhajH'lifefH,????????ǽǽǽǽƢ>sis༓oal.@nѸɸ׾׽;>yifX')lake*heLordayP ug߽߽߽߽߽߽߽߽߾߽way.ϻ7Ylb EletXtywhoulX)RoooooooϺoooi`ulnespseext Ijogg/gggggggggggg׼OOOOOOOOOOoOO/߿߿߿߿߿߿߿߿߿߿߿߿߿LOVEerspLAW.?׽׽׽׽׽׽׽׽׽׾׽׬ri">How yindsfeautyherere! &evennuQform! holi Btqworaffords.߽t>

Thoupsomethingikehesero0inyindslowlyurnedx,"stones(:un,xmeXialdecay?????????????>khtw)iv:࿡deadGOOOOOOOOOooOO77Asɣ@vslowlyrmtoKra inscriptionsc??purporthyy-sa½busnxious߻߻߻߻߻߻߻߻߻߼߻hxewif`wrattg,alf-sHchilhh@dit׻ca)rirth,wstruckZlaslab,aZ,7777777777WW76To©* Deaconnosudlewhoihhredy@.~Myycau` f`orR well??knowpersitcorded.t޾xtȍmh:venerable''''''''''Cize="3"acHBookmanldtyle">formroseeheesrsttsedoifromheeacon'seat, pancientsraelite.oordsou`haveersuadeximfhropriety g`d{psalm⨸8nd,quickhye/tur p`ؒ8broadisaP1ohH777)ingallerhTcamchurchbuxess7777777777WϺϺɥtesponsib0zyȴɭygoAДho.AederanceLale8goodUto(enjoymsQusoungster,ehaQaow٬ owsXfrpulpiattemptoccasion0xo pife׾׾׾׾׾׾׾׾׾׿׾֋rsermyund@sm0xiseZwHsumakhiIkiefsrabbit01xhih(,ks0wapappl>gerbd0uaӍPdinn`lCarioHdiscreet(-[doȸqn(wousoberlyapXthcroHaisle.u@oҨdurcxؾ߾߾߾߾߾߾߾߾߾߾߿߾ߧ(porYifasaweaPbrams'seek(pdodpm0Gfontize="3"acHBookmanldtyle">topfheeacon'seat.nstantlyll apples,ingerbread,nd whathey탱eefo."gggggggggggfߊ߉SomencidentsPisifeillhoworelearly!seraits.??certashrewdandholder,apofones,hoasot">reportedqmatterhty,eaconnosaluablot77, eceivҌxyort;ut,nPriousretencdeferrgiving deed.ohafp,(ied;,a;'s''amazem((Lwhe0foșitYveryIذ"jPȚ(dauers.??????????__?ߺTNaid ;iXex8or'nary:Qalwaysnew`Sethϻϻϻϻϻϻϻϻϻϼϻί¯xsr@y(arpboutcXdXnkawoul'''douchrQp--downck.ظJ8ai!toOOOOOOOOOOooON'Squbestatyease seef)anydress.dIkibtet,ԛ"he;D2Oel,ouowrǾǾǾǾǾǾǾǾǿǾǚ--+əYas,venA0eadg!T9X߾߾߾߾߾߾߾߾߾߿߾޾Ynea`tpproag(leci@kspecifyhpheavycggainad.ntMdmittn׾׾׾׾׾׾׾׾׿׾ןD,ĵEnomforyhimselfthPsoliloz`,\W ,湀*h,2lIhpyhotwoirlpoorcrYr(>hopetillohemomeood.hersilence--weon'ayuch mattcPdIophyheryustcǺǺǺǺǺǺǺǺǺǻǺcouragme9childrexurutsy;ailgeovidѻQinheexmͨberee//indepe(nt,a2oughfdaach8Dwell''''''''''GG'&pored,Șswaeard)vur solicitan>handnarriage; hease offithassurancepat,f` (.+''''''''''GG'}When2rea(?ce'sariDXEnosnsie?????????__??him)aggri8dyfarwi=hefh7">subject+strengragh઀lungs.Os??????????__?>inHtbusinentryQXchorpsu`fir77rs--roppSgolawbitbeqgooy//etit--arHyhurxmembAb,sure!tP7777777777WW76hsuaory\ipoo,idgone!籧ǺBuh,"aidusan, &Deaconnossoodan:oothink heeansonjurenyne;`exmusteom`istak boutt.ӆ搳youittleool,shavlwayAh,epliedSilencwou(cheated ofryeeeth递xdbmeOOOOOOOOOOooONc)ۖwwwwwwwwwwwwϡϡϡϡϡϡϡϡϡϢϡϡBsubsequepev0srouffairsAPs(woamselnlosergggggggggggfnecti wixth9swphallrocexshow.ϮϮϮϮϮϮϮϮϮϯϨG''''''''''G''%ItppenQhanextorPbHWwaertapߺ߹farmer,crabbednesrdeЧIdima`of'ߺ߹UncJaw.higreeab@surzaccordvery4eralgharacteristicoSers and еYiposs or.e׼׻d-favoIexprcountena8uch emblinga (th-east)storm--arizzy,ettl sulki,+se8ٽ''defy sp`jlearиHfxtakomtiowngis.јvoivȆhnnY,@sYadmipkeepIsawdetrowGpsphygnomye(exdicd.y`tendow@onǻǺyivacuthair-splitt1m whicм Iyfontize="3"acHBookmanldtyle">questionsorisputennyoi(ofheompass;da eeeQ mowxS MXsge9wQbehHtow~equalimportakepimxsyromear`ew.Noaat)xprivatemHmenش80vnsderyooooooooooonwell;tnncPJXInoXsfifcbles,Gusteedpho)J,arrpiwholength___________^breadഹcawiAllRsYheI')QIOOOOOOOOOOooOh'd|ဣmhichoaccomXyflow饹.@reo,hau8rvQilitHf0nd!/span> mattersouarrelbout,ndfettingverynelsenowherehey,.too,ou(mus,hatenerallyucceededneepq/////////OO/.wholeborhoodyars.~?זזזזזזזזחזAasqDeaconnossumpoffic9e-makxfor777777777W770village,ncPJaw'siencyendXtonecure.ԗXdǤǣalways8llowT@ps,mooth,usIpʣw//puMarithqiduitywtruwofulwwwwwwwwwww7ϴϴϴϴϴϴϴϴϵϴΗVimselfarerespect]3ص,QcommWWWWWWWWwwWW>ll®goxsouun0p n,ik777777777WW77кseeadv`Xeppropriaton)o`csi777777777WW77hiwnyeStHt؜hki(leasdpa(venK׺׺׺׺׺׺׺׺׺׻׺Enos`firretv`ouswhiQtakeroѨhH; onimarr "hobeyvym@dam,OOOOOOOOOOooOellIoGrannylarks(gelؤSeHScboutwwwwwwwwwwwOpastlot,els'&tZiahš9widojrshup¢rtpigry 2ajA''>frAHse.+="0"> Uncleaw's rime,aynisputeetweenim"'SquixJHs,wwwwwwϑϑϑϒϑ΍QfaSusSilence;or8oappeneHhisnds!WWWWwwWhosf feHchiguous.ow,ƍwashמממן׍Iwise:nGA(qPaill,hichb;WWWWwwWVaverrHi alwayX-floodingmedd9.As's77LbyatuxhalfogbulrushErexeiab>toXuBwetditionbLrybscurity to??????wIwacamPromkanyЁr׻ϻϻϻϻϻϿϻϼϻϺnlong)sh0.oaozsubjectOOOOOOOOOOOoOO">Efa@d,oecredsexwithettup0lawsuit??????????__?>abouG;Ի9 caseشdy2,Pdh*estleftSusSncP(Ǽǻau.׋zކreportXachK DonnosPd׼׻behʔY0dupءd`rthүgooooooooooooncom9ote(Teven`sYsiB`etlyrfmusqQpdѧ:bigiboȔɺ׺׺׺׺׺׺׺׺׺׻׺֬exar@monitoryymptomPviatiGXߺߺߺߺߺߺߺߺߺ߻߆YoocraperssohImadappa.f󵀓an> himselfirectlynrofhe,ithislbowsnrknees,nd.󆟆s脘spreadupvercoallpedpDeacEnos'sil////////OO//littleHquisitiverayydemar,yofopeningsubj, "Well,b,8'S0reones gHtast.ɓǓǚ_________^wond(howuchPodllwipdoHmow?ߙߠwwwwwwwwwv77ϤϤϤϤϤϤϤϥϤΐYۖpliWБitusse `s not??׫׫׫׫׫׫׫׬בorstrivqafter.erouyᬐtoZlis????????__?>certawcarry._7ϷϷϷϷϷϷϷϷϸϷϗ_'''''''''G''_Why, UncpJaw-that Ѷy᩵;piOwaPtrangedidxn .oȇmAofq(XXoakffpmed syne--Iokt8'p,rett07777777777WW76twentimةbyeu`keepo;r`@ ndg eisgalilencfuHbamakmoreϿϾnoisesQSukaveot:l:xoueIйHk7777777777WW76HWWWWWWǿǻWWwWWRHٶ6aushe hproducanyympaticwwwwwwwwwwwvexcitem0Ļnosۖ!sitholeas׼

emotion,uietly`emplatingheopfZlokitchenhovel.ncle<-󆟆Jawidgetednishair,ndYngЀmodeattackorner''''''''GG''direct. "Iard 'emell,eanos,atsr8erv@youהדsometh nndyortbrixaboua'eXlol0.cOOOOOOOOooONǟǞStillo@a@noeply;⊸ `'serseveranceasXo????????__?>toexoffCИommed'SAbeЗe,ia'd__howmerنsai"d8zee ituxded/߲wwwwwwwwwwIoXhim, '׌'ysɀIbetrettyoo'''mostyX,fwjAOr@dI߸߿wwwwwwwwwwwvfi8aocreePat;a71vaenOOOOOOOOOOOOOayl9roughwisticalasesna9w.''''''''''''''smaineute;hfitahile,߼߼߼߼߼߼߼߼߼߽߼ޱ?dith,dBut,ahy,z,sh likoahparulars.W____________W3Iamadepy @@ab)busss,____________ZsaidWosntonec0tHild,soxceedPly7777777777WW7WeitelT񮉆Jhopel)??quer;ȡrebetpQselfqstatementfiswn grievances.ׅׄ//"Why,ouee,eacon,ۍegan,tpsamei)akingtongsndpic uplllittlrPisposLmn2middHofwwwwwwwwwwwvfire,--Ítwoaysrter:funeral, (forɇ8dn'tailly??likoyoo,)steppedhashvmatIwitlSile; asSukesXha'1noordo3suchha7777777777WW77ouPhiteen.ow 'Squʍؠ(justᓰxeed,ױװGHway捹<')l betweenlmine,OOOOOOOOOOooONI:Ybuiaew(;rwhXIo)0easufou>rdЍi@pu'mo9whoHwidfӇfJmO,8ou@XvI@ˠlfit.//?)usor  becausjest''be\out/qKsoth+I'peakPϻ9,eefRо ɳb"ɺߺߺߺߺߺߺߺߺߺ߻ߺkprettye0wɴ,MdiϺϺϺϺϺϺϺϺϺϻϺϬ !קSaegularitcheattle--AgalQ'acream0se)eath!doiknow8Ѐyju/ߺߺߺߺߺߺߺߺ߻ߺpoorukeyㆸncl0 @frQencarey--isặ׻׺wR5sitrembl"AelicatP'sinderwnt>

shameolaguer,ndoɀokrco0awayorhatime."thenlyonfncleaw,ine,ealthy,obusto`whosedo oneuntrick Panoɩ9anisal`vo1, (;deacon,uxho7ooooooooooooM!rxsep8lpsxokKSusJsd(Ie(cialߺ߹protecti1drewrȏȤsled9lpo!ϹϹϹϹϹϹϿ/ϹϺϹοumsqaphmetic,awitbodyillagdinnerϹϹϹϹϹϹϿ7ϹϺϹbaskeknockdowbohandesoluteYhipY(snowbPed׻׻׻׻׻׻׿G׻׼׻a8qottempsameanpes.earsass''Unchadešhcoge.ȽXmecausPid,'' Y"aYeX;ustR'SquirebeW'''''''''GG''Dzram iJsCsoouu.Cɹ@as7777777777WW770rememncefRo@favoؔ:+9$petC/////////////cacrosxmiЎEno\@chxopengleamlregarjIfuturSo,OIfinishߺface="Calibri">hisrelection,heeacaafteromeeditacaoutith, bcһ!h tdRckeм''tevXXaw:tY@hTeghi⡐bs,e"'Foxrambl0'Um7777777777WW7o]clatqpTame faPaXofOOOOOOOOOOooOWhem;:youe,collegat'sAso--`rpb777777774an>first." hungryeaderyettingnreforeimheincedies, shouqusan."OOOOOOOOOOooONBut,ste`whyot?aidheittle퀀en; IinkhalloooooooooooookAnTeisnoneoildlyositivepatilenceasϖϖϖϖϖϖϖϖϖϗϖamazed.___________oןoIWupon 'arthilsou,{ǖshe,peningryesithooooooooooosHishmenshaven'tny piritn`1Deac`Enos'W??when hdo8cruus4߲߲߲߲߲߲߲߲߲߳߭7777777777W77likeGos,replie<֦pwaysi`mHI//////////OO/9girl,XdXam `Hbe8Œaad`nnowGGGGGGGGGGgGGBWaYhladytatXaϏϾYh,odwwwwwwwwwwwvjudgofuInatu@generxyupse;utissilenctowwwwwwwwwwwwwhomrlanguageoppositi arguaBireXnew,oulߺߺߺߺߺߺߺߺ߻ߺscarcJherarsredHforPcity x7ireeϻϺedxact0wsaidp,n(auchoudtonwwwwwwwwwwwvoi9withsmheJHm:assHraa--odǾǽeasonwhich,fjstrijlogica`h1t쁈t (c*777777777WW77>veryespectableuthoritiesmonghenlightenedndear`. herselfpoheagnanimouseterminofoingUquilt.Accord(ly,znextapwhxuswastanQefor0erirror,//brai2pttyir,󍀆\rtledy"apiacognroom iffIahangeabsilk h??ornibumakj;z"grimPl.+ߡߠ77 Well,,Ș,$ifouill@/+i7ϫϫϫϫϫϫϫϫϬϫafnoon,Ʉnkts8ux0seeO'O____________ZWhatpeop`do ɣhnveniehelyJd8notf8p rei0asesHenYyᵸdispos9iands?ϻsup sYrchmt,9spiteѼself,aughout'trcHyes,Zto@sis muc7׽׼oblig3Xc.opQw!toger.GGGGGGGGGGggGVxnce!metime 8thrgely#impaof7sdupone'sY4let*⵨ram@nO߻߻߻߻߻߻߻߻߼߻߹Tfpno@paon,ڑ`erladiquidalksc8al,7777777o77WW7youXs!cumeritz variousauxore??????????__?>expecɻgivivacitytheveningntertainmP.mothese1 newly-arrivedosephdams,ustromollege,ithllisi(ary~honorsPickboutPm,ecamexinubjectfnversation.GGGGGGGGGGggGFItasulyanvasswherougle)m1ȁxdǘǗ/andsomxHaffirmve:cbylargeajoritylthough7777777777WW76)Ѐ)arirsexcepz;nepartyecץפ?wko1inHogtatBculҎyoym9that!yKxa(lQbeau!lyHr߱vigorous0disputZo@~Hwoȱ. 3XowLll,pX,kha0eengretown!rpAays%(soquirȕ0orimoniXyngaged;negbeIundppdAeyermselveHith0ictBo*lcaptusucwwwwwwwwwwvpr;aprophecyLrecedҡxims "Cnow!{ϺϺϺϺϺϺϺϺϺϻϺ΅DstillHushournselike.׺׺׺׺׺׺׺׺׺׻׺ֿ/////////////.AXJong-wished-fo arrd@။rdswwwwwwwwwwwwwvZ1ionXgસmakippearancJasooooooooooooo{mdm:Xth''ǻǻǻǻǻǻǻǻǻǼǡ_quot;Thatsoedams!&q ;hewasheusyhisper, aall, well-lingou0camentoBroom,itheaairfneohadeen(veralPsefore8nd not bebashedycombinlazeyvillageauties.Inruth,urrieJoseph AmadeRmosty`esidenc .wwwwwwwwwwwwpayA1ct(espKGr`( MusȥfH @son''frank,l,opȽPɶunonnPow{eҚ">uranȋ*ink,rircumstQpcoupleasouk!anye0effort--a2gichowr Xetx(="0">poi`of1t,sbviouslymproperoehoughjbyoung .e convat.eh(Гqeye@eryccaQ ryroomfsxchsometh0 re.׿couite?t___________^kind0`owɯٿexp@udd輸! //////////OO//>ceivаtʼpfigu MiSile;Hwto//////////OO/.sYXscinstladؿ us!weeav׾?????????__??>reaЅy1rmine7cea8d!speakordga(hUncleawrxy9r@;shwhtakyPrprise Qfrank,te//hYyfriീ"X'do?*woYis8ǽwwwwwwwwwwwcXi addom(!g 08ndissilenceaveer hand, (epliedithraciousnethatmazself.tisooooooooooonmomentxlso,ertainoftlueyeseep8for@fromhcorner,ust"toeef(asiusto.Ces,Xer)as!qameark,ǓǓǓǓǓǓǓǓǓǔǍ_ifult rnIbehiaKsfIGGGGGGGGGGggGFspelling pdistric`chool;BSusJoȠa䔘ghϠϠϠϠϠϠϠϠϠϡϠΓthoseimnondHhyhappen㠈nksucw?????????__??nonse.߫߫߫߫߫߫߫߫߫߬߫ް7777777777WW7OJHowsourstlittle9rich0lorkeYspiriconstantpwecamejeeks;dimples,uickvarythОattlo'="3"ace="Bookmanldtyle">br;helear,ieyeusteringurls,nd(bovell, hnermabowaoody. !lso;╰??????????_ePivonfuЧM,Rntena`ssuOmischievousrArxʆlpnrit麇>mPaddpnotl8э.???????_??__?>+DensPit%thou`ewH'e withe? , !GGGGGGGGGGGGGFuburagxdashHin|pmidcircfPend?????????????>begؽ BPorVQname4out@rodu0on,membth8nevphappenePareedomwas f0ly scinatx__ZRexhowPndsoȻhpgrownSusan 8loreodeepwhencrwiHdarkyesѥrods observationithegardo@rself,nhatuickytelligibleialect&whichyeslone㇐speak.ndheeittparty@d,sy/////////OO/.dideryunctually nio'cloouroquestedfissilence/ߔߓhonor!attendingme--0evid9criminP@ta777777777WW7materrai`ime iAlady.true,?ϠϠϠϠϠϠϠϠϡύoeure,Suswalkњo@rPd*p,ԜP7ggggggggggg>hajusPhi rm; ɆYsg֧phtuchW/puzzl\unaccountablyJmʎHinferrfromfBncOwwwwwwwwwww Ϡ obriupndfon sZ//, "W1iyouay?X)goJoG;~formbinquirgular-tned//Э-of-@H)r0llxownpofellow-mor8 o 0idangHsinkCxamehpy./////////OO/.WheyartHp)gow,gav`urAheǾoooooooooooinvitҩkheseeim0yime,K8mellyard߾ϿϾ>)oȰpaІz:elsHhadpsaidggggggggggg//////////OO/.AsosephoberchXwaymewP`thous,ymeunacco associJhhZ`uHtopics`WWWWWWWWTibri">lonelinessf byimself,heeedkindrXspiritssols 0sympathy,n؆(riketters.׉׉׉׉׉׉׏?א____^ThatYoseph amtrottingᑐgith8sinnbasketoWWWWWWWWߖߖߖߖޕoPbrownchoolousevainlyndeavortovertahSusanϖϖϖϖϖϖϜ7ϝWWWWVJPwhomaw4ttleasteboar0uPotews醗______ǝ_fr!;anwaseeHyonH ,'GGGGFؙɌLylancupJd8iPe0yurlrou8it////////seexbevVdh`;ҍsnowbalXgomWiamsornocHgj'(oll88tZܷ_enchlputsumXح8metic;ut譹miievtty⧀1morecip`expeX"> opelessr@awohhLn(/////////OO/.pshawthuckfadH lfdoze'''''''''GG''tim#! _Yh]Hm0irch//drȲIthwIXPe.繧Ǻǹ"Joseph,kidncJawSnext5b0kfasI'p8ooooooooooon'SquiJ sqauershotA@lt`.{//////////OO/__YYAsir yRǑouero;ā6o#`?oooooon="3"ace="Calibri"> collegearnt;nd'lle(youowts"--thereuponncleawdirectly(wardSqu(nes's,oubtlessyxpag߱߰ocuurveyadp,o 3wall;ubym7777777WW77unaccountabpmis0lost+aycf(dmselXtIbb߾߽ydoȶx_Zuse.7}ToshadenmoarocracvXagqh???????ߺ??__??a?ultimatehcomponaX 8fsgarniture. iigrroom,stbeistrewnh߾߽lump)du Qv twicweek`as plendy׽׽׽׽׽׽׽׽׽׾׽carpetreyellowKblackAipewhiier1pa@߾߽>l-legghbra诉0ssil`ytgav9 ǽǽǽǽǽǽǽǽǽǾǽǽmagnifnнcxnechriyxcps y2tH߽߽߽߽߽߽߽߽߽߾߽ތ-hXshlRt+chPik!decortarch marriedouoooltprtnheirlacesniride.heanctity
ofastillurmaint edyeepingwindowhuttersalwayslosed,dmittonlyouch) couxcome!0aound//////////OO/.holetRtop ;ndt"occasionHf~extraordinarygnificenthroomZthrowXpeorofanewyes.ooooooooooonǢǢǢǢǢǢǢǢǢǣǢOurHrourprireforeXo(oth*doorsj____________XthipartmesymptomsvXfxseidailϰϯupatïpniturre1massivclumstiffness,??????????__?>buw)variouokeگxgaeتworkϽϼWRsieotabdgoodaJoP*ٽase">floaPwor)ee okpoetrya(ttfairy-basket,ryhicheepedgesoh1ruffl;ǼǼǼǼǼǼǼǼǼǽǦma writdesk;lasx`eZЍady'sϽϼcolleclbum,(vevery XprbowcH3scripssundstro((cuend"Tousan,{oooooooooonicoop@٬iry!p we@Mr.JosephdampSoaiXoimselfthisuieZbeauty蚟Yadmirf9 ;aXsequeupJcaк8s(ùnPorbHure,) e*ont>

littleadyererCnotngaged;ndromhesepeculationsxas`recollecѺ`𺈵8ong8children.”artieq/////////OO//fel Ieveepڢyоy;utXw''''''''''GG'&:wa0egerbMcametill0r;quested 8damHakH`ai(1W">inquip˭ 'ealthensuAus2icgggggggggggggf,itpntin,eemmfficuoreak#durh~pHtlow`assuټexssofRludicrous77@w ne8laughproprieHwouadmi'wwwwwwwwwwwwhavl@0oindowup`tel-piecPown`carpetts(;iry0ffٺgggggggϺgggfelectrical;heyothmiled,ndnaugheduhghtfterhich wholeifficultyfonversationanisp.φυ''"Susan,caidoseph, doouemembP(schoolouse?[???????????_???9IotatasHwereinking0wp;lbut,77really, haverownralHsoIuhardleliemyeyesst.Norminei alancg9a (yhmplimentarGϲϲϲϲϲϲϲϲϳϲturnexpressx7߷߷߷߷߷߷߷߷߸߷߼7777777777WW76Ouradaymag;af0s¼proceed to//ncsx`fid0ialinstp;{fromac8ofOOOOOOOOOOOOOarlife,achߗ1lernsomeiϿϾven1toriXurs(fiBdiscoX@aumbh׺Ǻ//>newsdmirabl(raits,usЌmatsY/////////OO/.moccurre.ɍgddϼϻwitasechpkSusshou htwo threenyposs;(ptitude t\A:ca,is{m "to-mor.??????????__????????????]="3"ace="Bookmanldtyle">Foromei(ouroungriendsursuedheircquaintanceithout
Joseph0err!himseЁrissSu, ( lBrootpbsile؁צצצצצצצצצקOONremarkablyinearnknit--att1hichet١oooooooooooingrJAr8dyg+ڧcredof߳߳߳߳߳߳߳߳߳ߴWWVbe&;a4iBknewpwShavimself.iJmembXvagPhoirdirectHpacktϻϺ/oPtasspsausic,brouhpunctual߻ߺsXqsolere:Kpeopcatoge輀mϺϺϺϺϺϺϺϺϺϻϺfuguytunesehap`chestnuts.??wwwwwwwwwwwvItnnotuppXH!s9sbHuyicbHhwakefulyh;@ev up@m Hsuh,rulartars;T issxBcasI(w1knowPo>certtyLRAyeqr elves.ԥͿelbeauxsp8pittiSdQoin@jokesϾϾϾϾϾϾϾϾϾϿface="Bookmanldtyle">anditticismsommonnuchases,hileheladiesoberly upousekeepingnerwnccount.oeure,hehg(tobserven <0iz(3"rCalibri''extraordinaryhange醻sister;emarkedhat "latelyusseemedׇ׍GFp gett1sort'razy-headed;;9#otahaJyWWWWWWWWWWwwÏhultyfor1Ȕpod80erbrwicandgot??????????__ύHceimTputymustarehhHњߛߡONsaltcellatablecl;lehcin9tXhalfWWWWWWWWWWwwdoze@s;*rwhscolzPsinsfmissi8orϨϮ?>comĭyai0f0yؙCdilittleorШ ne.GGGGGGGGGGgg״Silenc(aô+ѨSweakPnaarvy,//////////OOactualconcoctxunmercifulitcjfQmwood⢈set,ϼϻwhichakeepf*3shak!0sЏPHϻϻϻϻϻϻϻϻϻϼϻov.napo protesѻyw@nough;͡ϼϻwttѺ1evenqent8MJosephdamGGGGGGGGGggGGwithotatemȭI;лh8ts0arsSen GGGGGGGGGGggGedhiscѻ(iner,a0@//////////OO/.l󒁮shou notexecuس׺ooooooooooǾǾǾǾǾǾǾǾǾǿǾPg꤈fnoparfromkyoufri(׿׾whoSedost:Xcorea0ntO??received,ixbeg8thinkjleavestso2size="3"acHBookmanldtyle">xyyesorynHherecreteelings;ndhenQhaveihole or,o lovef1cs.oѠGggfs@busyithJknitk,8ceXknowsWWWWWWWWWw׭׌bout8iSilencll--׳776o/Why,usaHaieP9ou xakɗ;toch!ǷǷǷǷǷǷǽ'ǷǸGGFW)G1doѾit?sϻWWWWWWWWWWwWWUrr0gHTsomeءshswer,塨''''''''''GG'&eoom.߿߿߿߿߿߿߿߿߿߿߿߿ߠo׽oQNow,ideDa,ay1dow;sea(hadeencross-stitc; Zis2matt=,r.dams?׽׽׽׽׽׽׽׽׽׾׽ײ߻;Missycertainlydisposed,$repliroravely.Iusggggggggggggettak"rdvi!Ø.wwO}followfrdoow`ptood𽙲oWWWWWTfontize="3"acHCalibri">atheoon,ndeggedonowhdistressher. spirits;shtsqperfectlyasy,’`punr8ߑߑߑߑߑߑߗחחחטחttack0iteosebushearyOOOOOOOGGGGgGGSusan!saidʉph,yis袑sanemadewwwwwvtart.Ө0ok9curlaphpгYaYSusansZti.romeveniv> Sussteppedboutithაart youndserh(before. sX.ɭ)jPtrickmale;Iuess0ǸǸǸǸǸǸǸǸǹǸǭК8withm'm9a-godowa 'regularQh'?????????????>:oilencpl@nowBca҇ٺ08Rx.ϺϺϺϺϺϺϺϺϺϻϺο'''''''''''''&Saiusan,rawZxhe`in8(l`______________pprehsiv0@isr.damseGGǼǼǼǼǼǼǼǼǼǽǼǑG;Wp,oe?ellwIifis?OOOOOOOOOOoOO?No, sister,isfaa--Uncleaw_gg_WWWWWWWWWWwWW_;s'pose 'tis,hild--scaresou?Ӂ+afrXhim?fYantson罹`atimI'llConoy,ontize="3"acHCalibri">Missilenceernittingorkndarchedownntohe : `ssxA,ikeho sitdow(regular׾//comfortabquarrex)meansqmaositǕtoss1eadhsdainfully,uPc1o 0mpilitieswwwwwwwwwwwwwwwwwwwwwwSo,?d 6,eerateyoun'tink'llȬygXot'eratter77777777777W7777777777777W77;Ws?X3,ithnntonationesemblinghatf roastedhestnutheturstsromeire.υυυυυυυυυφυΊ''''''''''GG'&"IXally8ou,issilence, 'erealkadyouboutߐߐߐߐߐߐߐߐߐߑߐ'Squones'sn'Ko-ǖǖǖǖǖǖǖǖǖǗǐ?Mr.dams,{ai0%tellq,oeg,'motoh??Jxuc@2is3wayy.ٗhattommdecy,rשרsensЄanielٍ(Zs@oemy??far;xwobearv.ǴǴǴǴǴǴǴǴǴǵǴǮ?Wh070Uncl@awEhow9!מure,?????????__?//es deand8nQitas!cX(7777777o77WW7saiDeachEno(hen@0alot--Vy,knoh`so(Hnevele`im(vel;T)ieߣSil(stargreeÖўnpWWWWWWWWWWwwWVdownlack!蜀骰befo(say0ord߻߿߿߿߿߿߿߿߿߿߿߿߿߿ߵ;Nraill`jeemgettoucXwW׽׼ߺfWn8n ɪpass, folks;ize="3"acHCalibri">maybeheeaconill,ecause 'Squireonesashurchember,nd <ȃ13Q________Z"Civil!hou@likeonowho〺beQ.ou, *aswellpdo,hatxareayingthisutflear,eergliness;77777andJ'spkeep rou:eborhood.OOOOOoOOMissilence,Pidna8Cn'ta`noardordithA.GGGGGggGFIprettyuchnOOHVrusnkϥggggߪߩ'getyoeȘȥ'pose2wȅʟAperhaps鍸GGGGGggGFybesyYshgpatters;8seIokggggg߷߶t'dsonhraillyid謳caff;oϸϸϸϽ'''''GG''lhimfolks`havomeAgnsiderabstartOOOOOOOOOOOOO;,fmeasuord؅; sQotory!ܓk |'re'''''''''''''aIKXr?8werq aiQasha)ofself,hwshBɵIБ,0''genotionnhead?ight="0"> theeautiful,owncastithoreofteninghMissilence,ho,provJXtusdidotmmediatelyespotoeuestion,ed//////////OO/.herYaarmkeager2iterd,--ϒϒϒϒϒϒϒϒϒϓϒΗ''''''''''GG'&"J!hy0n'toupeak,hild?C'GGGGGGGGGGgGGEGaPr dour0,$shffz8Xf7ǧǧǧǧǧǧǧǧǧǨǧstra9en8selfpaschgnitysomeittlelowlifts___________^itsadenp0s`be񴡇بrops.___________׸ @aid, Ievwouhav02ifɘ )ouxؿwXrQthsɀPs.r.damshllZPsa@oisjonsmI.fwisonowymor迨cte@bet I.ǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿW,hvow!"i@r8yalncJawsutwwwwwwwwwwvdoorߺwwwwww׺wwwwϾϾϾϾϾϾϾϾϾϿϾTxclamatiXainvoluntary;Ynecollectimselfbpicked߿߾C`-guessmwqgeto um5G>begoepar bYurnroubef81Eor¼r߻ߺjMiPSilence,fouhouldoncludeoonyhingbout`at 'ere fCjusendordverdetenow."??????????__?>Swit`t(nڐ(reply,archedpnSusan'sittlϑϐchamberphpurroineasreatresolutionaooditf??wry .ϜϛϠ'R,idoYinkhadeenuch fool,[axtheady. (o//wa`,('veaillyiofet ried,bJoedamsalllks!O//////////O//OPoor!nierin:r rotic4ms77bЄЫeelsauo0rlfuldeas,:fp`kengbirdhroughzfairyXhfirstove.ggggggggggf!!beHnyruff0 voiceoiupgggggggggggishHsecHJtrembwhispHevoself gggggg׼gggg>feltst1defihQcoa8ihpmeddiithȽȌRs's෹adss//manoHswer,Ƚcisobt@orepf.''g߼Miync=aetheart,8l!a e,Wqeea8maʥbeg
graduallyoubside. afterll,y?"''___________^Ion'tnowhatant,or;nly,ilence,Hw??ifouovepromisetoaynyhing Mr.___________^Adams--.OOOOOOOOOOOoOOOǟOWethen,,i; buSusaxraillysnǧǦRhis ,Xaiٗqbeendhme?ĞQ٭??t*'m @muchAaor,Z1ouhaxeginnpﳗM!could`--talkboutgϾϾeiKaitikʨ--aemarkvincϾϾϾϾϾϾϾϾϾϿϾgre`discriminatio`cert@lywith!conversb'ered.ǿǾǾT)yHeɰPrrie Josep0edpwnwardsdwf7777777777WW78siss,oPsoanxietyo result,knew⿐isWWWWWWWWWWwwWVfa's tisfihappeara@deneclareintooooooooooooohfamilyoomfounobodyrXMiss,o׿׿׿׿׿׿׿׿׿׿׿׿sitt,穀sgyptisphinx,titcXgsvigorousonmealWWR bag,nhichHterestingmploymeYhehouroperoeouchMr.dams.wwwwwwwwvOOOϩϩϩϩϩϩϪϩOsavefortatew0familiar1cr8sǩǩǰGGGGGGGggGurnsAfle x԰1alolv9ouаGGGǶǶǶǶǶǶǷǖmatxgi noc820mpٶ???????__?>makimelIselfnwelc qra@ rostutumnal77rih(ЙdecayY⸠leϽGGGGGGGGGggGGabo@mpxergeticY,Proowtongscshovel¼׼׼׼׼׼׼׼׼׼׽׼bellowwh0 (lGiece8rp1rHs,3n,akla8woodp,m`8ec`oassybacklogskIaciَceoWǿǾ>roar1Acrhbney.ϿϿϿϿϿϿϿϿϿϿϿϿϿνϾϽ"Tnowdopl Xmeth!liX@t,airo;_/drawarSbigockchai"a8itϾ'*ubb"s,irfr(omplacency.issilpeooked notp,utitchedouchhester,thatne inctlyhearcrackf*needlendwh؀threadllve77apartment.ߒߑ77"Haveouada@o-nY,' ?''''''''''GG'ooiNo!as2gruffswerGWWWWWWWWWWwwWGBAr;inQurrybothoseags aidh,lancing aX''''''''''GG'&unmadpnesٰlayyPr8de׶Noeply. % i ll"ourYoimself,I'makea??????????__?>speak.W߽ce'seedb8drownrhzochaire񿟿O0friehelpeca ᆳ,cakѡঠYǻǻǻǻǻǻǻǻǻǼǻƬi,twltprYppositeَc)pinn''hiork[s,ommAdtitchfrafullyqualO>0/////////////׽׼e콰upfidge,ute0with fastϽϽϽϽϽϽϽϽϾϽ>thHbefore;¡h4XJ0adiedyle">ourero,lln "marvellousilence.ԁpeeganoH Hodd idoow had`eryfдyatpart9Ⱥtimegggggggggggfdurand@no yer8hu;⻅o׺~astonish eyXhendscb`tiZalmost纗i8Auab0nt*S(nceaidwnoooooooooonlxhalXmusؓngry.uro,owe@,ٱXuisߺߺߺߺߺߺ߿ߺ߻ߺbuss(ith flexi!pHa,npinn orkJmov??seam(oɠqgoonc؍ve8ityOGGGGGGGGGggGFP)Mi؜pXg`vanqedj8loudxugh?????????__?>hcheemQovulseis.׷Xeupo<____________{8foldup,upyўallassuOOOOOOOOOOooO7mpud2triumphant,ndemarkedousan,-- ӥh9dpa`lyicalt@ImllaySϸϸϸϸϸϸϸϸϸϹϸΦmediingnhYlePsubliheneparfromWWWWWWWWWWWWWVover9iQim it`affecattendantsɺ׺׺׺׺׺׺׺׺׺׻׺consequeГ0Pirerevolu9Hunexpturnus׺׺׺׺׺׺׺׺׺׻׺giyHYideahursuopportunity`madeqhimselfexerhisowersY`mPbtmost,ill//////////OO/.?ce,eclar@t Missilenchatorning.//////////OO/."No,ou vokpreature! ai usan, mi(laughat___________^!absurdityidea_ߙߙߙߙߙߙߙߙߙߚߐ_ZWell,ow,on'trawnro gai`/doseph;ǡǠ'"haveeenry9to Xg8n`ownlleve,fouldOOOOOOOOOOooONZlet.eriouslyI sometpful@sseo׮׭betwmyands,utXshnotnquireIiGGGGGGGGGggGGwas.only,rank)Ҫ hasxpre adisapHbation׺׺׺׺׺׺׺׺׺׻׺ֿpmentxorbiddɻhooIwithh@nd-7And,onsequȞ1Ieleasefrom‹sobligRs׻׻׻׻׻׻׻׻׻׼׻o, p03askoXYɧextrxaccommodrepli kcanimiseϼϼϼϼϼϼϼϼϼϽϑGoh;inivupertͰ@adBunl,indeeHeelsdictatmou@ changed.''______Ϻ_____'O,--no,JGDarnes know 9ٴwǺǺǺǺǺǺǺǺǻǺǝ!if9rrjecBO?"3"ace="Bookmanldtyle"> Calibri肫''_^"Ifytherbjectsoou,selcomeotmarryaiddždždždždždždždždžLJJoseph.WWWWWWWWWWwwϔNow, C,oeeriousiusanOOWell, n,ly,,nowobligationꛖ,n砧ǡǤinllatelatejh0fortwievdutifulG??8submissive, Phav8llegeoyriden f''''''''''GGGDon;ut tthsoxiduy:wchoicf᳧ǴǷwif7r[mostike`affahappinessears''''''''''Gxfhhceasedbo𚊔,a1)cultᅬ,inclin",⿢reP,dttleadIh߻߻߻߻߻߻߿O߻߼߻take{erty.׼׻'Butifs 8maangr8ws񣁥nhooooooooooos;I`w@u0Ptwa X*prospps??7777777777W77WhР}Susadothink苠myselfpende`upmyC,::pr*nnglisht0whono9g0sitwaxforXney m@im?o!%energ8oooooooooooo>educxwithQ@anp carey+ggggggggge>too,henasteffndelcome;",sosephpoke,isine Thisashentroductiononefncleaw'seriodicalisito MastJphyl0;n elaxafurauiet77s@andjacuqd, "IX`know!WWWWWWWWWWwWWUYes;brailly,֝r'ereX a ettyn. itel@'yolkouraHniY'ifKaHol1.'/?'Asosongoٮ@marr`er?kailady;Fkwwwwwww׺www״loagoGooooooooooooooooooooooooooo;WP--no!osyeere8tw barga(yet.ouI,ǿǿǿǿǿǿǿǿǿǿǿǿǿJo(nevpaorؿtcopغ׿׿׿׿׿׿׿׿׿׿׿׿׿ownadwhencom ,ys, ''won't䓀or;'Iϰ'dHm!ePab鶇old???????w??__?>fencȼallo`m8m8ddersQheI//aulp@Susan's;ndhouldikeo know, *deacon,owhatotusinesssoingurnut."Judgemithj'Squireoseleyay{mylaimitillt,/בsaid e.Th(do?SxUncleawmuchHtishtion; s'p8,ayou'llGuwon'toOOOOOOOOOOoOOoIIPqreplie!meditvely׵׵׵׵׵׵׵׵׵׶׵֚&asoroughlymazed;#anyne havoubtxb___________^entersuforfiecefi` obtainithPaooooooooooonproblem teeyohisowerssolvǽǽǽǽǽǽǽǽǾǽǻOOOOOOOOOOooOYouyrn8shtgirl}daf`longOOOOOOOOOOooOauseEbstripE 0bestart Susan'sparIiddown hundrdollaQnnailiI'hgopqheJudgemith`d 'S`Moseleywill荩goon ///////g//OO/.law.KǻǺprickue!xattieyweager0;paxbu8to*disappointmeratelyt="0">laidtntoisesk,hutndocke,zresumQseat. statinghat(ereasoeomy eacon'ieven,nd@ se0invitem.7ߌߋ77"Why,(gotfolksately,aiPilence, Shave'''''''''GG'&=soften?oedams,is '@some 'cutp'hours.À,/מםI`Xynow?[o?OOOOOOOOOOoOO?9JxdresselvesIeteadJoseph;Y,tepp777777777WW76Susan4low,yroom,pispЮ?ǴǴǴǴǴǴǴǴǵǴǜQشФRarhtychstoppedxorcoloO/">viotly3;omeanǽ;Iϼhe777777777WW77ogBNo,;bIan't,deЀ.׺׺׺׺׺׺׾׺׻׺׺׿/////////////Bȝ,S????????_??;Odo???????????__?OOOOOOOOwOOoOOO≉ggggggggggggg">
"Why,owtrange,oseph!<13؅_____߉߉߉߉ߊ߉߉Comxc2myear,oueepeaiting.fhavenybjectionsnthecorefroprietw`illalkbout Xmo-morrow;kdur77777WW76heroedoaucy:hresolutehawasoispufur!;@,fterittle 8e`rBblushionusan'sart,'''''GG'&aewisses persuasQ” uitoPM˥/////ϫϪseemPtoerouЀqaaPigna.WWWW״״״״״׵״״Attabimidd0UncxEnosxnorroomHsePd׵׵׵׵׻WWWWWwwWtw8awy઀h egalpinPʤBeven!#fullyade___________^up.Ա`hsp'SquiMle٪as8pxlxla羗">particularhis Xm0sf]som(aw8sxyHߺߺߺߺߺߺߺߺߺ߻ߺޟYrkab suijoHf(nd;殙(f`sٍinc papers,etartedp,lapp`hisraverroth@on @ack, madeworreelourishesoundroom,sneizingolddeacon'shhtiolently,xclaim,--___________^בא"AllHrq, ː !o!;hurrah!''''''''''GG'ϛ}WUncleaw ere@ًwithoutre٣(mhair// sayק//////////O//׫Trehatouao e.ustshourea'''''''''GG''mh.߶WWWWWWWWWWwWWQmerately Didn'tleo? 𻗻caXi8s arIa:owwi((lawz?g//////////O/////////g///O///Lr@MAdams;ˡxhave0hhd'swwwwwwwwwwwwo8iI'make⽰off)LerrnrryusJoneϿϾ2bur/øиp(o abit󿐯Ragirl钚rwithfinerortionwGGGGGGGGGGGGGGGGGGGGGGGGGGGwropenheyes\mazemenllato,?????????????>mhradualexdingdRsfP@iimtoϼsw@Aa."> <ȃ13Q________Z"Well,ow,wan!tengthXjaculated.ooooooooooooǎǎǎǎǏǎNJoiIejustsay,said`deaconGWWWWϕϔ''hy,`at'ssamegiving2galiveundredollarsutfouroooooǟǟǟǟǠǟownocket,ndain'teioneir.ۡgggggߦߥ7Skt; bpIaH Iillh؋?OOOOOOoOOH8up'arXfor?dncleaw϶϶϶ϻ'''''GG''''''''"Toakee,tot3Qhen77itsetterenerquarX,:so.amWWWWWWWWWWwwWW;yhilnrd;--hvoiceled--Ctreasures?????????????>lin(ifcYhapp0wY.ה"߻ߺthou(dost"l:adzXmiose3oWWWWWWWWWWwwWVpokedixedly,--////////////////////////////*el=Ixlie@ vow,Iyhain'to`omethingpd绯ϼϻp'ororlQ'iowhos--ٵPallo,foeas nobjections,ndatheruessxon'tve-"''''''''''GG'&~Tshortf Xattis,aidsquire, we'llJeddinghocomen;Lwith8aexrewpenparloroor,toousanOOOOOOOOOOooONJosephnrecby windowileӀ(nc pRev.r.ǞǞǞǞǞǞǞǞǞǟǞBissel drawnpmfdeacsadyasweepЁWWWWWWWWWWwwWVAhearth8(yadePdoyevsiѓtyrrived竧ǬǫInstantlykhYBledr iddhof/proom;erryeM(mplhd''Adesm#befoXany`enwȞ(9about,___________moAActualrogrxminis,qaAOOOOOOOOOOOOONpreviousi ructemadtwoҸextraorpacelerity׿׾OOOOOOOOOOooON"Wh!4nc0Jaw. s!Ķbdwwwwwwwwwww?????????_??Fairargaisir,# Hryourperpd.7oooooooooooooiT`;mO>realoud,租rocee,muchhHorowine;f`ichockolemnratiogavtatemeofwh`f r"13"> concludedithravexhortationoheewouple dutiesf<ֆ>wedlock,hichnbe`risiblevenministerimself.____ߌߌߌߌߌߍߌފ777777WW76U(eawhatsrettyauer-in-lawotoodalfmiling,GGGGǗǗǗǗǗǘǗƄblusheceiv Z8tul party,ndn(ϗϗϗϞOOOOOOooONMissilence appearfullsutakbyurpeїOOOOϤϤϤϤϤϥϤϗ''''''G''#"Well2oi8'ereou folkIcom؀dsGGGGǯǯǯǯǯǰǯslickno, aie. Ion'Heeutؒshndspit.GGGGǶǶǶǶǶǷǶA+arlixpowersaccordl{w0agnal0r϶϶϶ϽOOOOOOooONgenermerrim_׼׻ﹷ׺׹smydispRGce엒ogǻǻǻǻǻǻǾǻǼǻdea`mainrengthragg`idDd7777777777WW76iaPathat;Icabo,verp '߹߹߹߹߹߿??߹ߺ߹ߵ;Dayoit )`n;Lit'߼gonle?wwwwwwwwwwwww;Joseph!ws@Hr,znextanbpittPt'''''''''''''&breakfastibSusaalculathYfeelinderrouWWWWWWWWWWWWWZis 'ereal!nd'lle(youhat,jestivetice littleelicateantonlI 'sortgage:txa 2,ithreenlinds,flowerlahem0ings,''''''''''GG'&ju0rorusan."WWWWWWWWWWwwWVϗϖAccordXly, yappyearsewveradsfjng77coupinZlongftMoarIi{ir뗐benetor,deacon(laid{reen(d0.ncxJaw''''''''''GG'&waso@rrouAup bymagnanimity%good0qtoⰷױװyiyhangebet.nstquarrareal??????????__?>na1a nYborh, PfinPhimselfHtoǾǽaAopposisidpf yxxiHhi)hichhϾϽlhSmewhatagiciaafd(ary3fie̽ϾϽxercispos;೘r@oclayfuneralbp}t, " PЦgoXsujpmayoro>go2|i ʼtimiɢ8jaw;//Wh!xouxis,Ah`w@sm'tain'tDonǻWWWWWWWWWwwWWWx'sultyQyow.߾߾߾߾߽mbp:pagebk/>THEEAOSE.﹧Ǻǹface="Calibri"> love.԰ɱ@ek’,k9orespirit8,//‹nancP3hȾt)loHnca lashes779expsi:eautiouthArrow,eubdu/''''''''''G''weet--,likeJpicture18./OOOOOOOOOOoOOM"Fl`! Vchoerry)usicvoicRRGGGGGGGGGggGGimpation@TurnouradaderXkgggg> hrklingaiden,heeryodelfomeittleilfullf,ornwwwwwww>mischiefndtiowithancAeye,xfoot`aHcarcelyeemsotouch(petІamihsoultipliedyimple i wwwwwwvlikeXthous:s (once. "C,lore,ay,Xid"_______prit+putown#wisgoodexle8voluydescendfromourloutalkpoormor.+'''''GG'&~Tfairpi thu djureobd;,쭐up,evealejusH@sapecttoenea Jlids--zdeep,ggggggfp(etic+riІhtraiQ@usic.??'(inǭį#0adx܁haveinwI@߼߼߼߼߼߼߼߼߼߽߼are do[*oseago1Neworkso ߽߼consterna!deminSdo;know鶘oubpityooooooooooonleAQY2`catXbIm.08loflower)isgggggggggggYP,likregularouquetutxfsiPpcarr7׼׼׼׼׼׼׼׼׽׼ױa Hty;Ⅰllр`endyfuspg,XɀneedfuXok9mrownoifts Xl.wwqMa selfasy<,at"FlorencePmileϽϽϽϽϽϽϽϽϽϾϽΐinHٝlgtalents;avensylumniew fory vorite."//gggggggggggfO,henounowusthatwasoingoay.rs(arshall,ɏpresume,0sespeak;hehereesterday,ds___________^quaticponQubjectellنhloss9rϜϜϜϜϜϜϜϜϜϝϜwou0sainso xth;said delebe(___________^bit)grhousssuchinta,ullfߩߩߩߩߩߩߩߩߩߪߩbudIPxIewʍlik!iӠH,asWWWWWWWWWwwWWd=׵ߵߵߵߵߵߵߵߵߵ߶ߵ߰׺7777777777W77;NYK8mrr`buїorwisengagxit;Whomh?򢊨intim[oggggggggggggoo;Oonly(fPdd8ncies';BdoemHFlorencwϹϹϹϹϹϿ//ϹϺϹϩw,ousin? ttlea(girl!w!wewing''''''''G''at!ypephens?ȋpabsurd!,justn(rZloldmaidishays--dresgllsoro(chiln,_________\n>makingonnetsndnittsocksorllheleirtyabiesn andron, QcookPsouay,--ifadopexeveryomentfy sϿϼwwwwwwϿϺwwww;Wft8`odd!ףh8giveople,wantoǻǺhom8Ⱥ--auplpotatoepamsuch''ǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿ;Why,ertainlXustsupplied;Prv minisXed8irجmo cr,hydd0yrPtle asurgraXic0onyYetpow׿ height="0">bestow?nowhere @yfoorhoavein(eelingnd
littleaport."s?__wwwwwwwwwvWell,aty,hink0eferfectelQithhich:poor77moregardedrabynxsewressndJwasomeguiteworxcreat:doXeve8counotafeltoreratefulfɘ''''''''GG'&hadeAarrelIflourǢIXvPthoubeegivQanyrgoVuhatϮϭhyallye,Ialwaysenll8t@P''''''''GG''1o`gofar qxmyyǴǹ߹߹߹߹߹߹߹߹ߺ߹ߴǹ777777777W77ǴĦsin,)X(nHFaBguftzisde,Gs8Э"o coars0shapelpi8rovisionsyZbYOOOOOOOOOOooOorlHinstebeautivarietytreesfr(cWWWWWWWWWWwwWVwers wIupposeouPr!--BmercPnYd;t toombooso @wdeaXPonce--gowVPittl8adygXpractIltzp׻׺befoglap re@sat.7 $*WWan>* color mhs. "Godless@r!hexclaimed,nconsciouslywwwwwwwWWWwwWWώώώώώϓϔϓwrMiHFence--yes,newouou8feelo,t.oestotakegggggfrabetteroeeuchဨautifullower?ow,illlonginglyt @Hnzmarket,Bweave`rosepaiandsomـXnyfm.hy,msmeiwortsH////////uswholeitt8gardened)be.nqhowbudswȑre!ustouX,Hd meP?!#wshall////////xsetp?APMarXkippabouplac8ir88on_߼߼߼߼߼߼߼߼߽߼positioh8PaȍSwalkaofeffecPthentHremind،i)¦rк1preserit_Rythnl.'OPesruly,tsai{; wbmIst򘰬anewWWWWWWWWWWwwWV.ȯgladmsit!OOOOOOOOOOooOǢ0better.'rs.epsAdownkgggggggggggffolaiecHf)phwhi ɤasuXwdheedGGGGGGGGGGggGTϞ,ptchٵ!arrangemHager`ܙdo--no,"3"ace="Bookmanldtyle">fortoesothowothhepeninguds;ittleprrround--a bestall,ecau (basfrZknewuǬelPf8dathouow,.[~OOOOOOOOOOoo׸Wa ٫ noonkLgiftdϭYom! H׸׸׸׸׸׸׸׸׸׹_^asQ'ser@lpl@loday assewbyWWWWWWWWWWWWW!jMrs.xep@appinechildlmostxgoiydheadach̤LippDecuptea,tr hm격somime.߾߾߾߾߾߾߾߾߾߿ߤ׼WWWWWWWWWWwWWUTrose!hwe(influenceinXwithfirH.hraOOOOOOOOOOooONڣ,o`peattendJxriskflower//////////OO/.awakenasapleaHrainrvbeguilpмsamXwearnirPfe.veryaigrotϾϾϾϾϾϾϾϾϾϿϾpuorJfreshauty--a @fu1shoo(const8lW׾׾׾׾׾׾׾׾׿׾דcenjoypossessors.sttoodnheindow, paryousometimespndaze,ttractedaitseautyiPnroudhappasary;oridv8iousI׌׌׌׌׌׌׌׌׌׍׌care-wornticthxdifferenthisributhoJf____________rpvorite.//////////OO/.Butittle"Flo.nk,s wPgift,at1re''aboȨxinvisibthreaȀPchfar`0l@nto9ebحHH@inywOneopafternooarspringall3efulenYce#owroompay沸!makAhnpQinmates.ȝ'Ǻǹa`rangwayHer,commendbghcha8C_>Mr Stepxs'stronAs(ur`go, eyestYdmilyOȾrosree;"H0ppdaze it翷?????????????>"HowautiP!ahhe?׹׹׹׹׹׿7׹׺׹׾//////////OO/ωYes,dt(ary; ɿ(givusaad8sweetϿϾ th)s.{ϾϾϾϾϾϾϾϾϾϿϾϾϾϾϾϾϾϾϾϾϾϿϾϚ_YAh5,*Iuph8irɻarks,pleas90raXruck%yunicationϬpcameheo givetou,yittleirl?"߉߉߉߉߉߉߉߉߉ߊ߉ވO,ecauseereoor,ndothershck(nevcHhaanythingretty.e dcardennce;lov flower`''muchkMissloreououtksogus @s.סססססססססעסח!Scho@stranger.׫׫׫׫׫׫׫׫׫׬׫סYes,ߔL'E--aautifuladTheya Xwasromfignarts;uPipeaksnglishustHke iQonlosweet?߽??I xow?xinRity?$saigentle,aPlygϽϼgBNolefpomehsgo,widow,`tichadf''disappointmh q. BϽ@he,you㿀fiHllbatunt'rs.asleNo. 10 -Pr߾7777777777W772Aorti afreceived@t٤aandwrit[mXWߺ߹7(mblDury8sZlifFraH7adelntol--9loPo!likjG!nPoH;⣈0QbeenbstaclAfatfriends, longeparation, uspense,ill,fternxiousears,headooooooooooonbelievedoceXlosov thatndpdXart;Zitasis|ouchwithch iveorrowlines釰plly.Butetto ejliving--Jrxr, `nᑇaiddstreamaye,yfreshp@idurf,hixdeeds indlefras׫___________ThmsaiPour (dersolp finishy`orHorDZDZDZDZDZDZDZDZDZDzǤhemselveswwwwwwwwwwwϺϺϺϺϹooombp:pagebk/>TRIALSFOUSEKEEPERWwwwwwwwwwww?????????__?Ixahtailqyomygrievanc@to0ent;XPyre,(nyilleelQmAhvyYYialBa߹߹߹߹߹߹߿W߹ߺ߳wousekeeper"Poh!S@yxnelorction,a`gisigart߼߼߼߼߼߼߼߼߼߽߼mh,ndwirlittweentworstg, whatxfusse7777777777WW76wnok4Hsimplettefag98amily!an'eforyifRre أؓHsoxtraPinad1in'77777WW2anldtyle">matterfousekeeping:nlyhreeealsaoeotndleared attach.OOOOOOOOOOooO'After(v owedssaiYYgeX''''''''''GG'&s`ho paP蹠,locatXlif?GGGGGGGGGggGGaeQ.yHynsismyse@usbȼemafWWWWWWWWWWwwWWisitorworooodnhoengagbhimoooooooooooWnusinessWǼǻIasx@jXfirdaypHatYc?ǿǿǿǿǿǿǿǿǿǿǿǿ">hammeroxbkcxkerknP:YwPpi¿hempgaiichs commonlyalledettingoousekeep.s usual,rpetsereewandtretched,aidown,takenpbeover;hformAreutransd׌׌׌׌׌׌׌׌׌׍׌con6illt stttorderg0appear.utow@mϓWWWWWWWWWwwWWaherePpoiof `.urQour usionXadokten慁mealsnyiscellane"poral ner,9fromooooooooooontoparre8]fireboard@twohairsdk,omteacup[aucewGGGGGGGGGGggGumblai@ignoughrpHiϴϳ'lc̟hsofagglbedcmatsse??thIRwX}asoom.pseleasant??ПitieqHend.Ԯ8hJhdisu__________حirs;`reeegula=jadministHgggggggǺggggdayh Ɍlcivilpdorm;ˆde,GGGGGGGGggGGswepdud,5hykniv`scete8aGGGGGGGGGggGGttxto.οqoret"help,[ Mrsrollopey@">hwt?epew yHpon:city;ǺǺǺǺǺǺǺǺǺǻǺƆ_^accomplHer?tengt2ofeoymentijyidyusbqdetcXiѺly Iy ؚJaek,ile, PXim@yAߺߺߺߺߺߺߺߺߺfontize="3"acHBookmanldtyle">nearlyespatchedyhebundanceforktome.tength,ne enXragemiea0Xs Htiva@Ӡ#proceedeggggggߺggggaskiirames; fqeghHʭxto׺~wiperwJasefئRsilkockkerchieggggggϺggggpreparaypeaIhiYladyʴr,???????Ǻ??__?>ai0arȲxriaisfeditatټxescape.77AftPsom reliminehowevfBm@'''''''o''GG'&Mrs.ԸihHebe's*KotinHlso,;s0knewo??umoreut0xnnglishnoto rHeer0GGGGGGGGGggGF1c@v@urqinqui . "Ha8aed?Ӻ׻׺ size="3"acHBookmanldtyle">"Yes,a'am,artain;headivedtworhreelsneity.c UIpeؾˆxndpa it7S1alupSopi葙saprasuspPoXifhad@enlxricalatyn rou:WWWWWWWWWWWWW7))elplesHgpjthyoulzmdIv>senPmxXsxhe缧ǽǼcNѵHw0!Vexcm_Iou0ouIiqed77Qworrfamilies.3ϻϻϻϻϻϻϻϻϻϼϮwwwwwwwwwwwyoesoYveD(,lrejhPolady׹׹׹׹׹׹׿7libri">Nothingasoeone,foursXbutinstructerhhthe philosophyase;ndav)spittedjo ,givenWWWWWWWWnumberlessirections,ɍ(lkofoyoomsupere`猷">oa KoH,awhIdXmmmakbOOOOOOOOsweep/A,tev|eSXhe@tha`ϙϙϙϙϙϙϞϠ@arobcomXyfosubeirmadeinnio߼߼߼߼߼߼߼߼߽߼betwet%p8om n1admissont> cempla&stithullsuzzl8air۠OǥǤmornXoncorexinByster( akoff assiPdoeXYP,oughmewh9byoooooooooon@beoo forsp9onwp&holbW">spxhhs,KoixwhaحdoHbehgydem\issb easoHrZ"all㳏'''''''''G'' retuj,pe݌apolitelysdre0r''ourshableoladieexc0"Hx s.hes?????????__??w2tgers1mcity7c1mak@hir8c~˜rodujfaproJ eligiQone--ɎϺwhundtrucktonishmewithichhgatppa8߻ߺIooHdx [rifisnuffl8taof( Mrs.ibbhaga1recsr8 cketǻǺIkerchieflmo`irvanqu>grav*pﺇevidAtha)ey Rpo`8olaugh;(`ve)ynt>

self-possession,pologd,ndedheayoZparlor.con!r0possi.?????????__?>AtengpoXwovanifrom\ageӤucceebyί׾׽knowactivcapaamselipaemikesteel-trapќ߽׾׽remai)meustƽ^n8o (aiipite.ԣoϾϽhaosy,ood-natu,@rxlasRorzcr!ry,׾׽burdinner,rlosiron۰@ own y׾׽thyBstȽɍwahbouthousallscom׾Bookmanldtyle">herselfboutheatter.neightt؀stopperromarrel Englishirl;r!geenea`knowhowYdo垈ywwwwwwwwwww2CwithweetespemQinorld. "Now,Saidɸ//////////OO/my,lI1r“rs.,E_usbegh0go򶛾l0esleplMary'swn''8.ulas! iodrepos1ruptX IvisX'')@rim-iyou`,hosomeekouxbx߽߽߽߽߽߽߽߽߽߾߽scrapbootskitc覨覺unYnA;`tϽϽϽϽϽϽϽϽϽϾϽMis@*smilҮXblusgave (erstYthagggggggggggggsmuhЅxawo.߹߹߹߹߹߹߿'߹ߺ߹޾7777777777WW76 WhؐB?8,@2ittlischiev`don't kh/plh?;???????׺??_??O,ema'am.; one〸,hoametightndeXoffeforeinheorning; LITTLEDWARD.ǼǼǼǼǼǼǼǼǼǽǼDZ?Ǻ=PHy1youornNewngl,ood＀catechizchuh-gochooluordertimes?fo,mayseeny''''''''''GG'&Un(bel; mosterIicular,Pctangkupr,wnZGGGGGGGGGGggGFteverae9xaysrestosHnthWϽϽϽϽϽϽϽϽϾϽϻYremembphisPrwear-b@coun@anceeyine"3"ace="Calibri">seemedrawnith "aenfronndheoiaiamond;{is lovط:thXʀPor@very!cly:qGod??????????__?>b(hof؅m퀨 J[osھ??0OYmselfXKexpect@itHOOOOOOOOOooOO??EʗUnclebel'ousKPa)0,l, ner??zorm,romІXe(w.ԗ3oMerosa7777777777WW76dogfmyownart,ho alkfstudy߼߼߼߼߼߼߼߼߼߽߼޶multiplicatioxablxclockXP@ckSkitchenoraictuits `unƾsettabe`erpicularow poxreesW׾׾׾׾׾׾׾׾׾׿׾n-failsupplypepson xangingverhehimney. There,oo,XByearlyollyhocksndornx-gloriesloomwwwwwwwwwwwvaboutZwindows. as"best,pthtsHedrhe___________^cupboardnnpȅglasssgreenPragusߓߓߓߓߓߓߓߓߓߔߓbush8py,Zht"1Bible??????????__?lac8 ano),addition,rubtRmultiplisumtal.__________^׿׾T yforenamPneatmoefficiepiece____________">humaypayoperP*0tyl(s oSиоOOOOOOOOOOooOk y`JpredominHngiseepsng;ooooooooooooohtghyn(裠beewiPmar1,'ey'suXyauritywwwwwwwwwwwJbrncr8nP"Ziv@nivgggggggggggfaft!hemsdssoQlikeloCXHOOOOOOOOOOooONe"chap.utlwifeftychlesab0ject1n3befallٿlot.ittlǿǾEdwargagȠYer,errier littlelossomeverrewnhe gef avalanche.eadeenwwwwwwwwwwwvcommedonursinghisandmammaillX2avataindiscretion,HhenyPuncle'saroHn formwwwwwwwwwwwvthwase(ome.HintroducifamilyxciybXsaQ.Ξrhher(uchcondemndignities,violat0ghl`s??st̖tI0yasdward.taina(1Hto'eaecorumjymostutrousHlfx ''hd1curls;"iIsamewheA~"Sabba'ay Hanplaughfrolickwith*yǽǽǽǽǽǽǽǽǽǾǽbody„ʚjcxway,o"neptsolH߽߽߽߽߽߽߽߽߽߾߽޼faqsnou@w,SifairmrouѽϽϽϽϽϽϽϽϽϽϾϽξ@'seck !ؼlueypoomcheekeeraesidh@ak*UncAbel,bmfyspcaresswin.?lmetaphysicorepuzzlb/rkl,ncrompڮspirmat;rudeviseﺗٌ0hongoreasonaphape,殠ii0ischief߻ߺ2Penergpersh٭tru`astonis.ρ h׻׺srPfr3AuBetseyScotchnuffSIHheight="13">
uphearthi(Unclebel'sostmmaculatelosrush;ndnce<憗>pwasoutryingoakeos`iar(spectas.nhort,//////OO/.9nose,xceptr(8whichhidptutveryϔϓhhatamenway.OOOOߘߘߘߘߘߙߘޖ777777WW76B(ofll zzleponow(Зdhim0''''פףSabb,Pr {dayasterdwardeemexertaselfbOOOOOOooOOpi)rlylige(@ainPOOO߯߯߯߯߯߰߯߭777777WW76"!muئlSxay!SrouxcAouشwwww''hen]Sho𻸴cuqd,Zl graveIߺߺߺߺߺߺߺߺߺ߻ߺcatecm;Ⲹthreeinutesou| pussyspperrough//////////OO//`Cberoom,t*heels!Xidiscomposuxof1devotiPxAuhBetsey"ysiauthoritAtengmy–eucoXusYitn'natur'Ͻϼeachyt0Ag;*nookeepIqbpkowQlot.dMyoorK! tnowЬgma۸q(rt,certa蓓,lo`8ulty">ldwqlittxcaseCXrubIgpectasupofurng*hmyas detailingisitticismsndleveros.׆ׅ//Inrocessfimeur(roa ompassed thirdear,arrivatǑǐtheignitygochool.eeillustriouslyroughe''spelbntackicatecm;from "x's efמםendykrequiriforbiddtiȀtntasǥǤca(hoPinormerry,fa`r(got`77CAmen.Aftis,maderegularusin|sayo1wholyunday `nH,t貙xhhppold@(wwwwwwwwwwwhea0down,ccasional`glancepfussygavep8.nd,efpracȆbenev8hturnϿϿϿϿϿϿϿϿϿϿϿϿϿmiљsal!dablefP9achose71,gggggggggggfwhi8succeeas @mɍ`xpected.nh(, ou织furdetail,ͲحEdwardYfaioliaHwonder.OOOOOOOOOOooONBuPo(t!"h0so@߿77777777777772wheninAuBetseyriʀQbariumpin?????????????>vain:ygrewapidHworIR.ȸpfaheasaidoth;onbybedsiPؾzni,y`eansffQ@acity bogibIbegps, Lordxhouastenur7WWWWVdwell-plPgeqtiAppar(#byymelГPynd ofoetr(arHadaew se߾stopPdІce,(Xrupon@ܾ___________^clock.e dȿHl(ؿgo,}vain.bxxb0kneelxdowoZ !gyѮC7777777777WW7wrokYroughusualm8rٓӻᛐguagelowthwithepfulashichsh n1getsGo??7W@so fe drawaofnd''''''''''GG'&Qcomer,refutgthaiyeshelptimep??t0bleL潟 size="3"acHCalibri">Myncleose,ndawimalkohomfbdepartedne.e mer@dpsquirrelittEdwar(lickaboJwathim Qhfirstp p e nwn//qHanorG `rencPsbrus`n߽cɶjuifPthYJ*??߻߻߻߻߻߻߻߻߻߼߻WiteephghշA8t"Howpppyxcretur's!''''''''''GG'kL'pilpe@ne.K//wTdapcommtoHmilamentati8allhoxdn׳.earav asspc𭠵hBPmaZmh0lobega fs;uri">hisustndprighpiritasnteredheloriousibertyfsons AUNTARY.ߥߥߥߥߥߥ߫W߬wwww77777777ϰϰϰϐW''''$Sinc0ketchingiracmodXIooHyencil,otصm!youaȵ) radvure ybe--0getsleep߿߿߿߿߿߿߿߿߿߿߿߿߿Imxw`lxblyHgle--؀bachelor,reoverٳh粿s ѿaponpre`d9sob(mindedne.est,oweHfladiesou`exceptionsgainsXnbHyoutseIill@rerXrk,nassatcsometimesbecor causea0mucharse؀ӾoooolitYo--bef readewhora _______Ǻ___^good--ntay,cisunlucky8oᇹlway/Ϻ@)ody'ahSAmischief.hawatch overy uprearing,PthandoY`aholermyfld8brsysist.yelativesor y燐tsemblanceo zubes,eigooxngelsor xppositelas`but`s''''''''''GG'&m(iciansay, "inmeproportion.7777777777WW76Asaveefinsinuated,waHQfamilycape-grHmong//٣;onhnase(alldomesp0weregularlviqhbAalctualȌimput ϱϰ'F2ispYeconfe$soliQd hioufound,"tu@mind.he˶0n erross-eyedewfairy-smittenч0cradle,cait that,rom{aw2exisXceMuȼ??70Unlucky;۫ut-of-timlܳmvayg߽߼wmo@pdwwwwwwwwwwwvWhowaysef0pXdoorsYcowea?tHenryQo"surewwwwwwwwwwwopset !coffepup bkfascHknockrtumblat߻߻߻߻߻߻߻߻߻߼߻dinnerytratealtcellapep pxmustaroif//onlyanxmrarm?y,gral//yfamilyOOtangl`mamma'ilkndottons,nd torepheastewperor Pa, HthrewownPh[oe]be'sgggggggggggfclo8sorse,ithllrleironingqreupon?hy,enry.ߍߌ77Now2thisaso "mcerepensenIolemnlyelieve@atIbest-naturedoyAworld;uome0matter~aractiof`\gravitaq--//generalisQJround--,et pxɫould,ingxq(ٰreakborndamageif//>ocaxneam;:mynluckinessanyseem@`ex8proporto)careful)ϽϽϽϽϽϽϽϽϾϽϻǻǻǻǻǻǻǻǻǻǼǪ/fbodroom @hadῨadachȰАYdvousirrxbility, ic@adetacularnecaryzo@rpop//quie١"rxciɰreis,\s,hilteppYyiptolopov)hair|"givn8troducyusph8lupYhǾǽts_!anipxpokeHatogeѸtsinrwothreickswooycojustpatrAso`brackѨ w1Ǿǽedisposakpsuгopunف`sip ȕ蛠armc, undesirecau|rlQne@etsggggggggggggdisconty-9imeh¾harmonnce.uXwwwwwwwwwwwv8orsfurnishoccasؽbe ld`ate me___________^8djs)atо9justAm0 pby//y-firxьa.ԓ:n`a(shilosophyGGp> ine:adusthatnreasonablearthichsotonformedPtodroomblay#achooXoeahhim @di1writAomebodyakewhQ?ertainlWWWWWWWWWWwwWVB8!feelgrown-upfistnzmiԼ(sgggggggggggfonerȼ @suppd,vPRly H,rsamekeens:ouchong;xq~ iztr?iscpen(withGGGGGGGGGGggGFlamatter-of-courHaffectioncravympathyooooooooooohbunprofitabXfash#orPages./>nou9beɠHsess!sstituYalsay ancᾯϿϾ;madenhappyyhem(anQackward,interesting,rong-doh child.eallympath,oomextent itheHndn;gggggggggggfbutowewrgor1цesf hood;understdesolatensignifiHcenotengrown-upeopleggggggggggg{shbe8Bwayhjeve(蓁toǙǙǙǙǙǙǙǙǙǚǙsclmor;yifosimilar??grievsdistseshichBaslocutioetforthuXrshimaginacoXive.WhXIsXearltdsiableooooooooooond`pccclam:(hatuMaryrcommakeisit;ѽ?o)"arriagebrourtopped Houroorpulloff7777777777WW76myrtyprrHamoy0ɇ1s؀aW/////////OO//>se.shallcri QfirstpPA, sGGGGGGGGGGggGFI8inkYbe8AimhaPspitXpy____________pectacl m,hap(klittlens77''P x`Xyrnlol8owwwwwwwwwwwvy8fifУieaboutpȲoQbhisPnPi羟AJdincArom .Ӳmay"have0Harel ve;pggaifmplykshon`Imfromfar;heayeememberedndistancefears rat Herpiritsevproseouoyancy,ndsunkdesponde.ung,Ht҆_Zstrongwell-gonedne//bordersubl.utabilemot9F`rioruf;Hehobinallpexcite//perfec,"JaXyerda0to-Bqfora.sfoooey@̭=idealmyR(n @سoooooooon(elfIteisupɭ0*energipoooooooǺooonwanoQsastЇ l!΢Cin~AghuJhasouietߺorwi!PnphlefobsorbympathXriPǺ߻ߺatt1fromosround.SuchwowmyuMary.rlacid1mqul'em迀@Pchoice.ӷhad ysceptibil9suffernYȽnobl2modelicatonu^q;uhey߾߽beendirHezatsteoncratpu()"׾׽preparнIȷtfeel |WWWWWWWace="Calibri"> Snxpr`Yletqwثˎ''''''''''GG''locktru8Z,Z morroclaim9ait(bedtxy''''''''ce="Calibri">countenanceellsovedorrowfullyromheackferocking

upsetrorkboxponheloor;Xahreceivedllywkward leave,ndbesouY(give `1qcomy.llifamilyonderwhapcoufi`Hlikenenry;utf*did77Am itasoPtterocassposof.GGGGGGGGGGggGFFrom IPv9ith)--ie so0persons`on//mrwordZgnif`uch@pndoesK~wroncharacX2ileYibvolegeni8'ork.ӰpquietPheart,@refeelingunfoldKm`걗educaJnot (sh bHorcybpsunshindflowin8fuf0xfe;BwhenȬwortalJdithiorlhYsdeePxunuah___________oyh(awilou meyLi fadeиGGGGGGGGGGggGFػxn`aven7777_Smbp:pagebreak/>
FRANKNESSW/////////OO//gWWWWWWWWWWwWWUTe Honeȫ1frank,ichresultA//8uspicious۶requi諀measu`ignoHcjbGGGGGGGGGGggGFI!:s appealourenerositytender. GGGGGAight="0">isnother,hich xranknessftrongutureind,cquainted esyt h p#certaXs.ey(eYd_߽߼littl0ketHcharacter,hi!may쾠 plX"Q߼߼߼߼߼߼߼߼߼߽߼ImoPHwillikeϻϻϻϻϻϻϻϻϼϻϹtaaidqAliH.shadmikheartwo:npgel--aHmbinja8myadPϺϹnkecurHhappy߿߾gggggggggggfTeea oKoxass)society g??mode*ɭ8HeXoener opular.uo///////w//OO/)Style">remarkablehingbouterasBprouduperiorityollisguise,n prI;nowwhebilen bhs(ktruRi׮׭#Оײwwwwwwwwwww϶϶϶϶϶϶϶϶϶Ϸ϶HextraHryȢtb؏Ƚtficialbjrs)oOOOOOOOOOOooOupposmvesullcquadlobeZypPso,gggggggggggf(AbeautiXxanprencyme،psocei!eyWWWWWWWWWWwwWWoiepth;etjw!,2mvandGGGGGGGGGGggGompacharac4(throughZsaHtedium.uWWWWWWWWWWwwWWmay3visitiAlicalf0our-n,dgʽGGGGGGGGGGggG8[.نwalklittle lor.ԾtsߚOOOOOOOOOooOOohsofa,eZallee*atinr,ichooooooooooonpeculige`mploymQs!syillx`(fini/////////////anorketch.~ri">Dooueehatrettyittleady,ith rklingyes,lasticorm, "Thenouhounotske, aidlice. withood-humoredmile.fissliceadenetration,heeveradeaeseft."Buteally,ousin,aid8littl8ad Iou@not inkucXgirlsoujKanygbodress,rdmiand gggggggggggfthat.77oooooooooooodon'tnowortQ@Imwpb%but,or~mywnarInlyretehtoe`common pXbe@lmiOsham feelsGods*`wovǺ___________,y H!honestxsao-- o/////////O//(yodyZsP;Git?/׻ﻷ׻WhxyesgggfupposeWya--<߼߻generaln8wil ac9ledgeIpve߼߻8-ϻϻϻϻϻϻϿ__ϻϼϻϻϻϻϻϻϻϻϿϻϻϼϻϻBut Xit鵫icular_[(ǻǻǻǻǻǻǻǻǻǼǻe@;isustwmattexs$disѷ).߻߻߻߻߻߻߻߻߻߼߻E߆Ha ]wishZgoopinPofrs, lfor arshamXownwheBxyn>particularase.owaveadepyind,hatf0sorrecn yourself,speciallyhenveryodysell遀t;owou`(@aYruthf`yneskezpjoint?"ߍߌ77Ier(erswhoadr9Ӌproטחtimhpl,ɖK,Cidl.___________סWqenωȧPlad,,$Is '#doMatbahXsome??OOOOOOOOOOoOO?;Nowqsupposerext 8mak ctesyѴCchaireroomefons75;but@iHnsiwiZcmony,GGGGGGGGGggGFillҿflxI$m.׿׾//////////O//Dǡǡgood???????????_???tntire77n' betti osteopl_׼_ﺷ׺_t;AsrscAPso;realx??strumywnudgm8#isXѷoowwwwwwwww>"Well,lice,neoreuestion.oouhinkamesartyrsikpor

andll-" Aliceidotnquirehatheuestionas,utegtoheryTHEABBATHooo߮߮߮߮߮߮߯߮SKETCHESROMOTEOOKFNLDERLYENTLEMANOWWǴǴǴǴǴǴǵǴDz??wwwwwwwwwPurit(Sabbath--isYsuchthingxiЀHnow, hitonwith Q(wp,oe0`ؽaosity!museumǾǽofpast?þany ,memoryakeimackq9unbrn8llness ڍda`ecsensereligioupwehichoeemxrood5very mospY,heckA"erlaugh ~childh@{chainunwЍ:onguBvolaРoᄃǿǾyouthimparevePsunsBheaДCconscѼ///////g//OO/.noteanimals!Ritwnravpose?f panǼǼǼǼǼǼǼǼǼǽǼrmber,3zm9gearlyoyj1livHԌ䴙I@spexbeneҢ@e="3"ace="Calibri">ofyncle,hineasletcher. away, weoungssrexplorxengthndread`troutǖǖǗǖstm,rhasgrsquirrelsbuildmudilldamsXٗ///O/.br.ԓXnkswerJR,htst@(toeso______ǣwahalPno!down.tast,ovidentis lgo//////">,xatXno mscepticismlatitudeYo@ion_______ǰsubject;RwiȦezregre@beg0p a `777W76fish-h🸥haɀpvPAarpreparatorytrudxwggggggϽhomeward''''"Oenrdon't@sh; eq ?+aidGGGGGGGGGGggGFlittleohzmeǼǻI,Nysou¿Phoaebomincets߹߹߹߹߹߹߿7߹ߺ߹givh`sims; YIouldcaQfӺЬdiutgoyaear.ǼǼǼǼǼǼǼǼǼǼǽǼǦǦÕA'scked,'mhrxccisan,''Xith@rll1ȝfroP//visitn> air; Ieveridike@`tRhatwhy `ehnd .#獯?___Hs!ϑ!hy,uKezzyheavensternalߜߜߜSabbath--onlyinkf!G''GGGGGGGGGGGGGGWeqInow0musterettyfferefromPatXam qbeforeɨ???>cou> (haowsomeGGGGGGGGGdisconcertenesfdmittcee sideration.絯?___]Tre8(uegXl yrmae geOoϺϹikcji(orr,QwaSba1YX'~us.erewearjdwx,tmpact business-Xm(ﻷ׼׻8seemergihousoastoupproachǼǻ?Hofh඀toyou,)Xs,tYst0ouЁrowpnSaturqn?on't[it'ssahȟzickedǼǼǼǼǼǼǼǼǼǽǼhilPnr?å ra@, ynn1let hsuchSagain.77O7i0hregul@exordium\G;I@ize="3"acHCalibri">children,einglinded,sheupposbyaturalepravity8lways .77777777777776//MyncXPh8Ya)gre@exactnesKZentre//////////OO/.hiHholdlpreligsys.ŕPyhwregar??jSundayhoesndherushingfis ,coat,asntirely concluded;:atRgo9downasun,KtillnessԆgggggggggggabbatheemeoPttleLver:whowellh.oooooooooooǐǐǐǐǐǐǐǐǐǑǗAnowt Wmorn[thoughlliiRfragrance,OOOOOOOOOOooOmotio ibeautydewdrop0rewink,utterflifljߝߝߝߝߝߝߝߝߝߞߤ&merryirdsaroracketrs*ye)couPsQlou/wwwwwwwwwworpstH,etin sucGإtick>mahoganhlo(audibthrBךsuzzblueH!whizoupinp x''''''''''GG'ndincPtemeai.̹nPefrroomcyouy߿߾Ͼ(uprormyտheКeaAnimmaculateM0sw!rBspreadpeГ#lijst`ideep`nsual vitQ@9o1toil-weatures.Asidhwell-brushe@eмsmohair,ܬӧusng8peoplHeadraXXaٺ@dkerchief, Ay)"firstrokllhixAunt//Kezzy`tr@ed˧؀omade?eexg1X//ϒsalm,lyHoccasionyivehdditerk''ooomhirtollaؓfteenpu1o san'sQc(oߺߺߺߺߺߺߺߺߺ߻dtyle">repressnytragglingookshatighteanderabout, "behold dnctӣinamateriallifei0himsort___________^Qy--atXg;RqsojGGGGGGGGGGggGFbet8;yPfZ(sseenG''''''''''G'' comt@labo SpilgrfeltconeotagȾooooooooooonthheyJ6# yH("WWWWWWWWWwwWWrn.siirhangecamnUArong} size="3"acHCalibri">ygrewld,ndisse`onefterother,Pmiliarormshatad hf8hbo8.ԓ)r9s񺀀Awt@ealǺǺǺǺǺǺǿǺǻǺrelax fdbSschool,ivoxhmAwexercisethQmodyre0useooooooo׺oi">information.urholetocknhisineaspeibandrimer,a Thebeʌameiscaneousercis˻aownPv(ion??such rsalmq,ackwaraW___________romDoxy,nur˙HBiblxsomwwwwwwwwwwwwo脨QdevicH emءaP(religiRmploy7wwwwwwwwwww>Wh[xfad,itiaP1feimw'?????????__??lд(upceildLfXr[arhQto ont> everyorner,oeehateuPdoext;ndappyas8@o#sainleaming `someistacrack,zforthwithuster goccasion9ettqdownIpicktp.heher؀Pfallewwwwwwwwwwvrecollectt4weddrinkfXsxcuseوut0//awell; elPheardstrangeoi0amochensBins8aessentialshwmat8;77/pussЦjump obta8,0us\spϮϭHv)rj;ilaostsiduoYatXlock777777777WW7/Ŧ;irb!.ȳuPдxrimЦPdqgYo0 eachﭱmakehzorϻϺlylyliffҴourAs{incipi8temptHtǺǺǺǺǺǺǺǺǺǻǴ?ogueryi gradu@ondermin(vity<׺׺׺׺׺׺׺׺׺׻׺bPzudd0explos1xmerreUncPe0ϺϺϺϺϺϺϺϺϺϻϺΘXsa@"Tut({AuPKezzݚ:aeeabou׺wdldrpbpkSabbathay.ememb(oncpowyxinBigoeepshoSXayyishr8xsjusA(s0isibwiPetsnapaa)sppethrougppwindow,@CiddءIpage.ll//nstantkidpru,洂mporYauxiliaryTnldtyle">wayfmploymentasotoeespised.reslyehildrenooked towardsill,ndhere(at,erymureXreadingible,ithgrasshopperangbneegrom1ornmouth,ick??sprawl؋Xn*leastisturbMWiam'syvity.הד>Wellurinuproariousaugh.‡9tamera77seaffairormsBgood ¡iĎcticexenctrxdutycertamo01moraluasioucOϦϦϦϦϦϦϦϦϧϭWrecomdedSolomon,o੨llreput@aggggggggggO߲߱GTrnqpicegivspeci(whollo/////////OO/>SunX`hichonalnat9similarcenPuntilunsewharsPunch uHXrhcla@d "Hdown.߾߽w}@,I (askedqxyulttstrȗs?idP׼׻noisgustouipSabbhҀrelig?o2d`.Ɇ׻׻׻׻׻׻׻׻׼׻ׄ,causenoxkindfenguɻconsistprinciple;Jcy xevenWhildrlearnpciat8rre.ԷlawYobedi Ͻ߾߽>sforتAtrsoquhHȽ8hx׽׽׽׽׽׽׽׽׽׾׽ְiolhit(a`ameyxregardxlikhommutabȍs height="13">

ofature,hichonehinks beingutipatienceith,0ough<Ά>theyometimesarardersonalonvenB.heffecwwwsystemaso 8rain@houracter er@forAabbatoooooooofricbaflifouev.ɍveved(___ייייייך׆oand،ylimat(n serAǙǙǠ???????__?>unknown`mPitQonlyecogndy0isyirth;nOOOǦǦǦǦǦǦǧǦhda٧nI@ng1)ae`Rf`ligiousצצ׭OOOOOOOooONawnynџ}unbrokstillnesȠ9placidpose,ggg߳߳߳߳߳߳ߴ߆HAsimplPevoPurith<.777ϺϹǼmbp:pagek/>ANOTHERCENEOOOOOOOOOOOOO7777777777WW76"Howxt(er mo"!aHMrs.obertusbxggggggggggggc!hurriedat"clock` ysittd)fasta. Rey,ahHu"b0oǾǽSunhIond8Johر HenrnotppHannah,xyoupǾǽhm?篇ϹoiYema'am,utcouЏqmakemind;+Җwãg7thlwave7rs.7777w?oo?wϸϸϸϸϽ3"ace="Calibri">"Well,tshameos,usPay,cXidrs.obert(sittingown sleepy-lqboywhoPean,y`ireatИabwithǼthЋleschi @ullate o稯O,ҧbyyearA dhgivor0omsӺ! ?d׺׹Mr. ̭goooooooooooElevHcenounI@liзrepۊųbutephensAPipssoXmuxnice vh,m.(thinkWQ

weadettereturhingst8ephen`ndhilips'snuture,y< ӆydear."////////OO/.Why?reHeyuchheaper?7oooooooooooO,rexl;utorisunday.epo kf''''''''GG'&o0.oys,veou졠edvrchoolessonOOǦǦǦǦǦǦǦǧǦǛ?;NoXa'am''''''''G''`wowtrange!(ewantsnlylfЁ`ofyimx77777777WW76Iynorei. jseb`effecfbeupOOOOOOOOOOooON1OOTqX sullenaid S wяasoonAanyelseooooooooooonin"s'Ǻt;Well,fa2IIomxcP,(caPkoutate(st߻ߺn;po(veen)f88rHgȭWeOaready,klonearned,whaosuppob8ldo?׾ϾϾϾϾϾϾϾϾϾϿϾϬ׼ooooooooooooOo ,lettay hthi morn;don'tnowyize="3"acHCalibri">lesson,ndton'toyoodorsox." [77oooooooooooIgitoy___________??????????__?,1Qtill;mu9atchtogePmehow,險i羇Sunday. re kR`!ȇ&xuteo''''''''''GG'&lineedle,threadcscissors;L,aQdo//////////OO/.to-JDymnfus@every jwwwwwwwwwwwWWWWWWWWWWwWWJylwaysso s׹John,lp0b)߿"Bookmanldtyle">catchingtgainse8downtairs. aseught." kept,nd`eyntendepoeept;uhadeverakenroublinvestigaterquiresmostrop`way,8wiouch//////////OO/.objec r데ieeklyrrangementsplannxwitהדanyef@nct.r.oberou ofpngageؔHsiness ˚??????????__?>closXfq,hichhnewfaueimrǠǠǠǠǠǠǠǠǠǡǠ>wearlistlon\;MrsallowrmilyGGGGGGGGGGggGaaccumulђsam)Эs)he `i/߭߭߭߭߭߭߭߭߭߮߭߭effompPh beȬЬSabbath,1`plexyworb7wwwwwwwwwwwfinding !yaloȔ*.ԴIܲɿʺptйHfȭconi༃dihowϺϺϺϺϺϺϺϺϻϺdePycrifi觡i8moneButftoppikeepǺ٘Ӳaour೼riskassaet,or,housey8fBjinvolve`srablɓcǻǺexpenseЙsdeemrovntial@"aQk׺׺׺׺׺׺׺׺׺׻׍Ofecit mercyk ttPYsecHqTeiP@p77>f H2reus:LRmbxh9hoH??????????__?>es cosneiH)n6ߺߺߺߺߺߺߺߺߺ߻ߺ޿77777777777776Aref龰(hiehildren,reEenough?????????????>strictnessoakehemespectiabbath,orfligionsntePt 70lovet;course,little)tra(reasrdjustnoughleaddisliand䍐isy.hildrenoonperceiirats'engs,itevidWWWWWWWWWWwwWVris0milypa2f(erjmoߚߙgeneralfoup)selvesurrieHn\i(hearts//////////OO/.mindull~world{conversatP!`wasoϧϦ`stanturnqwsowkwardrawnacky7777777777WW76sen۲dusbr!^app@(mo@obvlydzdzdzdzdzdzdzdzdzǴdzalogRatȟndid trgimPuriGGGGGGGGGGggGFdays.ǾǾǾǾǾǾǾǾǾǿǾƼ7W77mbp:pagebreak/>SKETCHECONDTlittleuietillCamd@(browauggehn)mopHuresqueBxNewngl;itsregular,pstuI\rLnotlsurpris>pXMr.ame `h xBH-spok(wiXl`aconcludoakePispsicemongm.șu`Pm߻߻߻߻߻߻߻߻߻߼߻prxy,enteelfeaprosromping,umiableϼϻϠHdrenåwasou@goodak؛@sboH> xnersfveryemberthemily,`atwholeiborhoodere>prepossedn9ir(vor.̀ Jamesas qsomewvisionary??andaoreticalurmind, uchabitfollowingoutiwnde@rjwrong,ithQtroublmself______arularly toappearancH@coursexmake5ey@owwwwwwwors.ȟHsupportordinٍelig;always_____readygiveimmonepromotyenevobject;~ghhd8 dpIcf@nor?????ϳϳϳϳϴϳcoct ğCe:Christians, @llseeme׳׳׳׺gggggggiteAforo|8worshiim!spirQinggggggg׺gggruth#̺HJaBiblSguxylifeWWWWWWWWWwwWVәbeenسupnd ysteminjudicious=u77777777WW77restraintrqde@mine8educat˴(hild`,)adopi__________^exact0osix³}tltshtut8______Ǻ____s4enjoymȘaim,oubtl8,SpPpria`;utggggggggggfmedcarryᥰoutsa`leas hich*nooooooooߺoooafeodelgramiton.ngariSabbample,纷׻׺7ns@r9haalHrpl8goѵch@wi8aayykeep9famiPquietithdoz!timgooorsoubhuXbetH.ccordly,fterheorning service,hichndisolemilyegularPattended,awouldwwwwwwwwwwwwpRrestfdayitchildren.nadearinstructmnaturaltorshowpicesxreЁ___________^variousccountsworkjGocombi)llsureligioninfluenc(8evoፈmimu sh.henwwwwwwwwwwwvepermiH7angAzthrougjields,ǦǦǦǦǦǦǦǦǦǧǦcolleВ@eȦpla,rai lakpmeanl___________dirYth3yygexspwar`oby anybeautifulr0npChag8suiknowledgwwwwwwwwwwwobaenab oiscov`Roi0out.hxunPwwwwwwwǺwwwwtr0sreeasonmodhtenjoyme0p&ggggggggggfTtomefficult aZirBHe8aߺfromounoisym0pL,xsawoooooooߺooonregre+animexcitex㔰2drwwwwwwwߺwwwwwpnBtoouriousnsidr, Hpartar,ﺿ߻ߺmexercisornq88a9Patory`߻ߺ^afternoon,exxleswhenr.amhl back7ߺ">ownoyho9rmbXx fr hwaR׺׺׺׺׺׺׺׺׺׻׺nyiXordily0whi@hadadcSabb face="Bookmanldtyle">muchearinessoim,eouHnotutpngratulateselfhenX pastoral gZvillage.ɥAnҸPdsdHownwcollege,membe򟪸arkabiousO׾׾׾׾׾׾׾׾׿׾ami؆ sci0y,yolvascertaBself߿߾ew`hlm)Zour3ucofensiveohe goodeoplefborh.___________^׊׉"This alleryell,y friend,caid,fter(adistenedMr.ames'sloqueaccou0ownymreligiousߖߖߖߖߖߖߖߖߖߗߖinstructionndtxffec@uponBfamily; Ioot8ubt`a)idoesorourselfjbu9ere oYohingsbeakenn(considerais@rsonaly___________mprovemh.oyZknow,,eostorthles@nGװװװװװװװװױװcpargreg!examah`sp ablOOOOOOOOOOooOOprecedIYowؼqir+iviolaȸYor ĽϾϽSabbath?ٓь*childrXboЧ(l,ithind_׾׾׾׾׾׾׾׾׾׿׾׾heȫ񫹬,ev@dtranquilldybetposeJ777777777WW76BPDxٹidl fanq`,ym@vewwwwwwwwwwwdomuchsXwhXy XohB,unnXGGGGGGGߺGGggGߋ61shor8Pskippston Hurwhogggggggggg>aundayfternoon.&9;L(e`(sw!oowncience,kpd. ;Ifɾ??keepB^uslyampvP(God;P her//sgress@, 'as輐efX.'GGGGGGGGGGgg@kmanldtyle">ImotesponsibleorllhebusesXatdevil-dised dutqxay totsreadyRlanguagxǺu`tacxn8mplify9illPngnowledgnaturalto`bial!eurbenabqclisresultdo?ـoneaundrhcd"ace="Bookmanldtyle">theame?ow,ustmagineureighbor, 'Squireart,ithisen buteyondhatellowedimselfnoeviationromstablished <''Bookmanldtyle">Afterhis,uchopeurprisefvillage,r.amesnd SKETCHHIRD.77ooooooooooomItashePosefsaSaturdayfternoonXatrewpy''w`yorHinrن0tittlewellingvillNgwwwwwwwwwwwThis, XIoupgarmescription,Yhou[>si0WiamletcH,identicaloguLB؁Fwhom7`aveoretimepoken.hadlwayseenthriv,ush-ahead//sorcharacndurBouambblife/improvedveoccasH oppXunitfeep lǽǽǽǽǽǽǽǽǽǾǽacquaintance.ԭhlast urnXtonatintry0''Oo`ysbse, xd1himmarri)sedľ׿׾8(econducta :sper g/////////OO/.b1esًptly 0ce0 3vitxopohsitOOOOOOOOOooOHwnmNowʥ|0exiyZH!itgggggggǺgggי¦li rane'snuckle fsrydoojaWWWWWWWϺWWwwWVTIwitHty@ockAIreYdbeHc@__________lop(,ordZ igoldsbalsamAtoggggggggggfjackPrdwelspaumbchildishoices׺׻׺"stopj,QthghushepIaw2im3"> myousinillletcher,ssedoewentyearsgo;same<13~boforehead,arkyesmart,ucyouthnxh//"who-cares--thatÍss1hiad.TPe,ow,Texclaim7ǍǍǍǔ?????__??yPettingownairfhoexhadpenlackxarrangAm AiaorowrAsortfrom77thosehich!veittao otpwar𕳡0)I'vOOOOOǧǧǧǧǨǧǑevery`nglen f [madȎ9shitoo#dYitקקק׮OOOOOOooO04minutes;铘nyodyinkQe8douiPr nWWWWϴϴϴϴϴϵϓdustiktryat'xll.#ggggߺߺߺߺߺ߻ߺ޸7777777776IXouldn'ugh saif-hlPgirl,@o dmir,idPlympswithutmorencоrroɖbi`kh,il`cpuup">playgs bighesIayoucomezturzlock--k huy`ngers;Poh!easizWProy,napp!his׼׻ӜAgot3?WWWWWWWWWWWWWYespll;nIeftuBohbal*QtofHd@ads,=grea`agb`Fannyaٴ--mʼHys babiesustaverlaythingsunday."ׅׅׅׅׅׅׅׅׅ׆ׅ֊//////////OO/.O,oeure,aidror,eryonsiderately; dcan't??read,ounow,se1,orxaribltorplhOgggggggggggpictsdtpiomeIeppedorwarHspellfmer''timwsoowerfullynehaɁApoispr(@ithHale蓀ll!Ismeeeynooooooooooono;u;2IurXsgr8Hmyᔐarancuбmyself.׷׶/Is rh?/dɊ￟GGGGGGGGGGGGGFnJroneuhIues sihyHbeئfews:oлRwalk '''''''O''GG'׾}IccepA!invitation,:ittleirlh𪘋ɱHam___________^retti(furnishparlor.Էzaiano3musicpoksOOOOOOOOOOooOn sidfroomؗfipicturesungb8l ya//,e(c tabpl8ifulswn.eQthiHtwoecȌ`eachϚfirepl(ad+ casalassock do??tyle"> arJ1hȠcommon *it[׺׺׺׺׺׺׺׺׺׻׺גMpiecՍ-abIBi;pti*cou8bsettldefinitivhoinȵqrZJl)Dtah,s7777777777@tize="3"acHBookmanldtyle">likenottyuestionsnongress.henollowediscusspver bachelcosuneasm`ndeeQe 8nP a?ϽϽϽϽϽϽϽϽϾϽgivePsu(artlYidea8cksIƾTihasϽϽϽϽϽϽϽϽϽϾύe8play±sмeФAboyis8rirlY0 s׽׽׽׽׽׽׽׽׽׾ת/alfHdozsorivѰmbyM@frie I߾߽f,essenceus8iX. IsamϾϽupr2bear"nfn0erfulxHvoica8н׾׽firenisye;nlyhat(eandfanhooddlight1ouched someylinesق,ivingmtaid *exprXion~becom qfar.׋׋׋׋׋׋׋׋׋׌׋֐//////////OO/."Veryell,yhildren,rs.let0r,s fterea,illiaHn77Susfinisunto`varioustxs~yetordʣnoon; ;Ielieveow㟐saour ek'sorkWWWWWWWWWWwwW,НhabthdoutHshenjoyselves.ïwwwwwwwwwwwϳϳϳϳϳϳϳϳϳϴϳϣO[papahHYpictu qthosere8b8hegggggggggggrou@躡forAla0Monday,Hh?dttleobert'׺׾׾׾׾׾׾׾׾׾׿׵'"Anm`youtsmoreboSolomon`temphis߻߻߻߻߻߻߿߻߼߻palк@w@t׻ꐗwwwwwwwwwwwϾϾϾϾϾϾϾϾϾϿϢɡulikekif@Q ࿰dswoRharduionghimKS ayWieOOOOOOOOOooOO___________/cɲhgoodime,7drs.letc. Bhyearchildren8squite dySabb?فay777777777WW76hpawayplaythings;cY,o,77777777i">allrongndnki8feelings?oou lyBpleasantxtowards :iniȱutxongorectlycep׿׾explanation''׺' supposene8askouMrFletc/;whei8v77fulHlearprchoolssGGGGGGGǿǻGGgGGGG;O,魸surRam.Y8know,oc2SusIXOOOOOOOOOOooONbusy4pmroughoZTuesqnpafternohwϻOOOOOOOOOooOOl jagainwroteown someuestions." anticipationsferyreatleasurenheorrow.<`F13H/_____OOOOOooONEarlyVningasousedromyleepysoundlittleאאאאבאvoices8ngYwithanim}ronextoine, d,OOOOO?????__?>liste,cauXfollowords:--OOOOO?????_??N "Awake!;yourQorsȐWWWWGGGGGggGGToodpraisppay;us0r tW1joyeailheerful ׺InnglovGg0PabG777777777WW77 tiSabbaday!'last[repprolmo8vehementlyy Ǿǽthatpknew͆erilliam'sO______________________^Now,[e,(likejorneHst,;aidbsofȐIittl777777777WW77Susan;jimmedisbegan,ǽ߼OOOOOOOOOooOOOLKHowweef ,''When,eavingurl/Syw eek!"> <13腗XWhenesusrose--wwwww''bestnpweek."?????ϐϐϐϐϑϐϏ''''''G''%MasterilliamPlpedlowithreapirisof(itune,oughɞardimbserv, xend irversat/////OO/.likyorn)t,hcause #seemqo pfoiq'_____lively;hPccommodatsifol@Iasx g`D agaredoublnimon.wwwww''ϳϳϳϹ________]Itaautifulummй\voiceschildr(iingggggYrdhwellcnotbird0flocksout--aooooooooooncheer,etabbath-ٝquieound7oooooooooooǿǿǿǿǿǿǿǿǿǿǿǿǿƭ+Bless(b'susic!|said(myself;howHchsnsolitaryick2ohUncleletrtamahoy翇Ͼ??????????_??=Thfamily@on`u`obreakfastoomuP0e77hadinishirymn. QtІparlobe0swepnd?????????????>gazexpr`fidayaase¼xwers,hichߺߺߺߺߺߺߺߺߺ߻ߺ޿Ͽȍ\Ȫollectfr38denpadorned theentreable.Ԁdoorfne9)bcasesyfireplashrownpen,resingoiewollectio0fttilyundBs,77overtopwhichppearednilt0ersbinscrip, "SabbathדדדדדדדדדהדLxary.windowseyGavigorabreǚmorn,ؚ:ird)atlidmoHrosebushe77withoueemscarcexl1؆ч8uoyaȆnichildrena*y @room.taXgibwr Xn(yR,??se,yhiestayweekȓhrrivedeaP 4hitsutt(oleouls(l''h@kfa]seasfam devoƻ''ge!gJr Zabgaȿa9pictu??new$irpurchasNpYorkbefcbeXer 8aӍay'9.1aeafudi(metDary,saalargeolumes,ʺ׻׺superiorXgravings.׿׿׿׿׿׿׿׿׿׿׿׿׿ֽǾǽ"o0iAmubYexpensX,ɗmarkm'//frienYnxleaveϽ/////////OO//''ndet hsoreplied; butPonhlxImhs׻oooooooolan>withhebyonsideratiPfxpensehinnyther.ɀpllt library,somethingorearticularlyelongtohemndf acquisireligiousnowledxq)probservanc$ϺϺϺϺϺϺϺϺϻϺϚ=famiHerprise.ouad,` D//////////OO/eop alwayseelrrestfop bj8ichyavevRoney.wwwwwwwwwwwwqsoucirst{bellutiXữϼϻcorsa!. childrenmpImademselX`adyӰȪpirfxpIsut{ 8ȩooooooooooooleacs,kt-party.ont>

"Now,illiam,I, doounowatr貱h8mOOOOOOOOOOOOONzperpriseSheep)ѿhHexpxed?_____________^I ppPembSunH 'QYpl'?+׼ ay,0IInkbverneϼhe,milz+IdWWWWWWWWWWwwWenenoughysehIrewp,smuIept''horlrBall3-blood꼨ionYmyϼϼϼϼϼϼϼϼϼϽϼcomi⌓someټ,dqenliv`ak缿߽߼iest8osetselfboutt.tasnefheirstiour housekeepingesolutions,atSabbath`beadeleasant~day,ndetQ inviolablyeptstrictetimepood77fer;weaverou ȍsounchanneloong[ǔǓieem’pnaturalrder."7777777777WW76ICalwaysupposed,aid, CJrequiredeculiaralent,morPcommoformaѝarac(plishyjany??ext ߯߯߯߯߯߯߯߯߯߰߯ߖ7777777777W77;$so▕remyriendb,sensea770(etermiH)do.ЖRshokdefinitebject77religiou(ucʹirild,通y?8//cvery2e`(ecessaغشڻYinPesem‡I''dselvwanths)獈rn''hese`,[readily趢RTsoura/knowledge??????????__??soumerHpopulȍ;hɌ allvail7#mkondifficultyf 9ЎPkeephǾǽcabbathimpar:7Ҏɵ`doooooooooooooenough!aompasüponsibilityHк߻ߺSunchooleacherchildrenoundaychool,heyoAestcform.ow,m almostown.heenderndofpedxpressionfachounXanceore<1witnposubduingowȆthosenstructshihad llHd''''''GG'&1la0hour,چirweet,ird-likeoices@rmondell hǔǓ8beautifuords,--ϙϘoooo''_r "HowlٜSabbathve!//////OO// npm0ngerQr77777WW7775Tholyhhis, Шrleave,OOOOOOooOO#AriHwsfaXprayer.{OOOO渇mbp:pagebreak/>LETVERYANINDISWNUSINESS.߼߻{asoou`nognaper?aidlfrMeltto 9cousinOOOOOOOOOooOOaine-lh,hoasbyRcentreableᅲ NI,ndeed.hathPfɐd08xdecidedvulgar//tem anceledges?shaw!i(aelishIwkȇireryw~essep!GGGGGGGGGGGGG____________Come,1C,dlliant,ark-eygirlshad߿߿߿߿߼beehosofaurYbonfer1, ;IexfJgivediveight="13"> overttemptingovangeldward.ouee,salstaffhit, 'hedexteسoippanage."~׽׽׽׽׽׽׽׽׽׾׽ֈWell,ositiveclaimpladsgentlemen9giftWWWWWWWWWWwwWVtinuapncommYexYdiscusszatter| Oldtyle">backwardndorbtillmeadyoerish.wtakeheatter inamyself,signem8anceledgedLeat&getsn0nonefoseauyoursesponhichou8veeeno//patic."ߑߑߑߑߑߑߑߑߑߒߘf7777777777WW7Iareay,kXidelton,l`ing her plliaXHthvident//admiratibbestx.ǣǣǣǣǣǣǣǣǣǤǪNButherysi maytso tunateǩǩǩǩǩǩǩǩǩǪǩǗ?;,]dmytbhabixoellroR,*mu8carrogicjeloqueisomooWWWWWWWWWWwwWWfowessvoredthusRconferRen蝷ߺߺߺߺߺߺߺߺ߻ߺ߿7777777777777zWaaooditؖؑ{s!af)hadleftoWWWWWWWWWWWWWWWWWWWWWWWWWWWRYesdisngAugabpsyll.h`tiXI9!ne arۡftOOOOOOOOOOOOONnowas?pas--ractHwwwwwwwwwwwwwvhotel2,aoʀД( nownǻǺocketndkerchiefoittlhoyHReHworis߻ߺgett ٙ:Pyte''''''0"> ilyepiHoʧt)whoseQlli capXngߺߺߺߺߺߺߺߺߺ߻ߺ޻Pn! pl(dimirstnheocietyywhich moved.hough wittroperor fmilyonnections,ihadecomeeader4circleserespppendagamosied,ndre77noneirmmuniti9privilethattreehisϔϓdisposal.OOOOOOOOOOooONǝǜAugustalmowas*picuous1all[l!!prof??feminiattainment.ө@ɤporphanaccآdomveryarlyתשoj!njoyɢxtrol hinde5I?????????__??>iumnce,oubtpadd`dmagic xsonalr߷߶xcuring消yfl edefx$beauwealt//////////OO//sehew'''''''''GG''~H`Ppohatur@yuiorough,wa(_ggggggggggggg>motiv8yadecedxvelop,xcepuرwouCOOOOOOOOOOOOOucصsocieNa!oons 8estgxfeel׼׼׼׼׼׼׼׼׼׽ׯǵd,jsaQbecogparzϼϼϼϼϼϼϼϼϼϽϼrivolousbei8le0ѷxinfluhn boϽϼd led.ph)њ@waybq9bitu@j߼(sponsibilitynQchaseemxogeoǼǼǼǼǼǼǼǼǽǼ>elevaڒragRfashionable~7777777777WW7height="13"> Generalxpectationadnitedheestinyfwoersonshoeemed<Ά>everyayit forachXr,noncedinotrr.ewhsfterinPvien鍠wereitnessfivitie8`congratuls*Xr `lliaHhappyarriage.//gggggggfN ByoungvcomlifediHauspices. "What??exacttch!#_eautifuluple-sahallBgossip6Theyץץץ׬OOOOOOooONYde_d 0;JsooupJ*oooolops!mselvWWWWϷϷϷϷϷϸϝǵ'''''''G''%L@,i8hstrharilr0//////////OO/_oberi0ci,dq,siatas''''''''''GG'&@ywaroutuH,Ztalbeh,//////////OO/pla)asex@xXaؽyDc@b:enme777777777WW77entirelyref`q@th3ouyy gLanJWWWWWWWWWwwWWFpalabsorbatt@m蘉endp0drawWWWWWWWWWWwwWfro9emptcallcom0yyhl??????????__?>winevenassPdelYinelquietuhhom߼߼߼߼߼߼߼߼߽߼߫readsangHtdhݬӿ'socy.utradictors itayppearohe poryfentim(hst, iseverlessჁthatwogggggggggggfpersonsannotlwaysindufficixcite)n Pkingeach׌׌׌׌׌׌׌׌׌׍׌oHrerely;(thhespeciallyrueosewhom''''''''''GG'&aseen8necalife.fta(ileeoungcoupoughov nonH`q,hgro)7ylls@invyemga0insoty,deridbyfelʌddxzes asuirturn.߬߬߬߬߬߬߬߬߬߭߬ޱ7777777777WW76AsgazradmirationollowsrXfuloautiȷϷϷϷϷϷϷϷϷϷϸϷw_rributarccirclAer7777777777WW77>,dward *a beyɱflat@IddsaGGGGGGGGGGggGGhimself,pd rd;Augusta,jȹDcovо??????????__?>tals pPrtظdisthuidrusb,gggggggggggounoes*pt`urg0DZQtrhwnH2hav9`imϽwwwwwwwwwwwlas!eiJkmnewCeril*؝0[,8Osuppoj0,෠ulienhvfromure:simplϾϽpas:homx(yЅriskirocapixzappinǽIt 8indul*fir@dxPfoqtra hmulN"3"ace="Bookmanldtyle">andeepestangeroomiceies.ethat muluseither ofxsafeels}always t?PoAugusta!howepoBjf.ӟjIemptڣ#rrouhusbYಢRsĬall/timulusxJintellec@ؘad!IzestsnedHry(safetG߽߽߽߽߽߽߽߽߾߽߻/Al(dyEdwomePmilixag9physicalxcien?WWV13"> whichouchesheery)gefntoxication;et,trong<1??????__??self-confidence,ndeludedycustomssociety,ream0notnjnjnjnjnjǍnjƋdanger.ԌtravellerhoasassabovrapidNiagaraayWWWWWWwwWVh)icIspotxerfirsitarkli0ripplexnousߙߙߙߙߙߚߙޙidownwareny1waters.ll؇is llia1beauty;7777ooooooon؆pȆ8nunm,yeemnlsfǠǠǠǦinspir#airitnewifL؇8topdful????wwwwwwwvfall.opproa"iemperQatuoth(dʭoulliksbuoyVexultqfreshnes*a7WWWW'Ⱥ9ponscious`Xeel8Ydulкhwiaߺߺߺߺߺߺ߿ߺ߻ߺ޺0I,gnoؚinexbhurrp1trem`sweep,׺׺׺׺׺׺׺׺׺׻׺ֳqlaughkurgXiYyoT8hoperǻǺrecry.GGGGGGGGGGGGGF77It@s 8tiodqEd qoneudi)ly??rihodvacourX poxuo(H//*e!eAceive8ms@pim.†amoIhecircpY acquaqsrezn1such. "Leymi??>qowusss½@irHXrsal`xTrue,adsgr7/////////OO//>shaken,Mr..0grettB.sXromigyoun>seemedboutouinimself.€oneas "nelation,fdward's, ضʩ`࣡evenxhistldrearil(r/HlHdhuts!lorAugustasit.ŗth ߽߽߽߽߽߽߽߽߽߾߽ދItasate,ndheadtchedxiouslyore usbQpyong hte0ngotdi@awayktu _XtoodazYalmoPstupefsilenc0;ϿϿϿϿϿϿϿϿϿϿϿϿϪ'enselesHusband. Itasateheextorningeforstupornhichdward s1lpod!עӇ iupth?earnest sϻϻϻϻϻϻϻϻϻϼϻA̼seazthnoble,Xeexpriof~sirity remorscouydoubtЮ!(husbJᝨd.'slofformatharidefect.tzmerelymodificیtrenchm𪀍irHon.e''ifeeltcaryQcuimselffirelyromhecenesnd associationshereemptadetim.e0id(dotat,nYeratelowf bloodzevenalancenervhave''''''''''GG'&obexdestroyed,`is,Irfter,ouble2fourfolliabilityicht8makр@n[portfirstntowarch.wwwwwwwwwwwvϢϢϢϢϢϢϢϢϢϣϢΡpstilltrivtomulsufficient preeturna___________almhealthymibod2oʩtant߰߯self-olwatchfuls8c8aryWWWWWWWWWwwWWϺϹItȫ`greatАH8lhingnit,i鿰monitoryrn(qfaqchol--an'׼׻unsuspect draunRvx-,=ȱt`yoq,yoaink)0rediablqllapse߼߼߼߼߼߼߼߼߽߼ߺ׺׺׺׺׺׺׺׺׺׻װx,)xspiri(famblqorIwilǼǻ\duyorbidrav]A-%߾߽>sys.nssfiwithhealthyProubuxess,/div> andheawsfradual solidrosperity,Rexcitedunsteady<13/imaginationstsubjecHtoaringisks,ithalterveH??unboundgain onede,rutuor.when,/////הדaotecashthat3comeunrestrГdeyate77777WW7ntemnceҚwretchHortallayzrav ߙߙߙߙߠggggggfdisappohmemair.gggggSuchhsEdward.eadost藀1iHregularwwwwwwvbus@simbarkp!bulk!atyaa lliam߰//nvogue;¨qfcXx)ren* 'eggarhrecourؾQfatstimulu hichlas!~nevwhollybd7ߺ߹A0Ie HHhp@tacit8sepaydromIϹϹϹϹϹϹϿ/ϹϺϹwifefamilplXinsidiou`ow Ȼ)tationaxincsedskeptp,rtificiǫblaggAvigoGGGGGGGWGGggGFXnervYsys(''''''_''GG''_Iaat ht--low#hatterpk@dmsoo,plpr.Թlargrtun(rouavanisho''mxntyXscarceitcemai@hs.ƪ W$ze="3"acHBookmanldtyle">distantityhereadeenouperintendischemes,Athusrote :*4yielde(Ihqaiwitmy7777777777WϽϷ7ormen0memporarefug\oler(ry.٧r mbeǽǽǽǽǽǽǽǽǾǽǟs hfi newawarunkarrok8anAX--sh I r geا`Yet,confid w,@wXonirll-judgeineturn!ai/ϻϺhs!nnareco xsȵblacssϺϺϺϺϺϺϺϺϺϻϺΓXdar9.ǿǿǿǿǿǿǿǿǿǿǿǿǿƽ"AlawifXpeerlwhm 7nd?ifaO`suchhildrgi)me?sareoth!HA׾׽unequplXX-- innocZ0Jelpbab׾׽iso fulnoughYpNo,܁X77776="0"> whichorthlessusbandasQoned.feaveouow,Jwill diedi(nattsecklessinX.WWWWWWWWWWwwWVI desperationhe신upood. "WhXhaveɀliPforow?7777777777WW76was@irst0eofǗǖBuH0repr0`zinquiryselfishgony,besoulmYyassistanceneraweak;mbegtqpractical''cquainABtruths[opesYrgwhich㮠gHOholeYer_WWWWWWWWWwwWWϸϷTpoPbilit:Aconfididolat#any hlbject 7777777777WW76swepxwayySallusb`&fueg#׿׾decidiIepirit,threwy PprotػɍǺ''LelpӺiollow%IcH ad_//Xe,uYimv8attemptQoave'OOOOOOOOOooO'"wIusualna!short-livHreform,x@__________^T)0betroyed. tasgradysinkabody,oooooooǺooonAXmorfeeHgRprinciple--shuPuapxach'''''''߼''GG'isgusimHs@HmarkHgres"runkardW??yle">Itasomeearsfterhatmallndartlyuinousenementn`e notncyanHitterbroh t8y/????????__??:fow`guilHEthrough׿׾wh@er.llopeQreformҫڱAuHydaway.erǿǾ/wnyPe,ad8thoseisidetail(toorevol tohor;0rdrun(Qre @nooyal0ad--nsalvogreatʸmininemeȹtaste,1te1dǾǾǾǾǾǾǾǾǾǿǸOeel`k`mergzerrupZaordhwϿϾ> Theraveller,hoetdwardeelingyHroadside@asoPimesstartledo@arfragmentsflassicalorPoriburswhalf-rememberpoetry,ixsngelythiPcile(rr@>intoxtion.utenhoppgazreJnourarkn//'isIiPxeyewhichcou eistxuishfromwwwwwwwwwwvloathndwestrunkp.Gߦߥ77AuguadP؜jihusbA`aitXholly~Pnownami hleahescapegradZɱirt8//presen!9osʍrmbett(days. loXdreadfuluggXZannihilatᾠhopet lifraisؽϾϽfeelsPtpnext,babi9munGod,׾׽'nducpsorrows\nohelconsolpgiv`aend׾׽>dign)characQsu׷~wWWWWWWWWWwwWWGGGGGGGGGGggGFI(xruЫ)deeplyvilPn;ut0ʳHolygggggggggggxsȆinspirtim(Ib08*Him "xϾϾϾϾϾϾϾϾϾϿϾ΋maderfectroughffer.þ///׻׻׻׻׻׻׻׻׻׼׻׻ՎForihakI@nctifyyself, @ylsoyP=ied7//////////O//_bsize="3"acHCalibri">Poverty,eepuhadollowedheirteps,utehe2not
Augustaurnedromim,nd쁀abstractedlyutfheindow.er

anothereal.misife--andinexlle Xast.enry,hen herselftheoorxichr..,hoseincely sionas of9ornamXfcityA.tnoillreachedsumptuousrawroom@hcogn8dndxmangggggggggggg`usbadrequet!gayxrcleirarlife.Alter81x,=did&r,utompas atpoooooooooooo0AahaiiBsȀtoireturnhisady,#ut;J(x,Hț(convpatithor~gye ?'''''''''GG''~"Now,allahe, yourltoge)xcevtemper轏Imat.ocieЛංoiforby喐xt)P~efpHtowardsBn1bo?HtakIc飲mself׾׽IPs @I,ymuseg:our(veٍ߾߽""do:sameTwill)xu . Yodewayhichsis !duthapiriɡ,next-doorϾϽbusinpjwroȇ1. Pmake0aeof~appancȦY dolit`ood.þǿǾǾBPsuppose7eelsitio@oow7777777777W="3"ace="Bookmanldtyle">improvement--whathen?" children!owiffeptromhatheyeemed,en,pcurenase,H someoYou;gotixfyAcb77777777ǻǻǻdo(Yߺ''''''''G''߾Howngular!ʖžre s allі Dardkembe,year?Ǿ/Ǽ?Yes,kj!¡usb!too.ԧwas`ochgffai_gggggggggggEd 'Ia᭘be(temperat`worthlessellow_wwwwwwwwwwwWhoouhav@hou@t\׿׾׾Butcoctֿ_G,Iredicted8(x`hsǿǾbe@talkhofgatwipartyhichgxϿϾaftMary'sedd,soxci]qhlYcenth߻߻߻߻߻0">''"Bookmanldtyle">mentionedhen(ateasettingntoangerousys.uFsuch Well,XRaAity,epliMr..; HowardworthdozenonsWWWWWWWWW;Doou0pposesaidal hadisbHfar@lence,ϵϴbiHmov0aircw;#niversalustomoϴϴϴϴϴϴϻ____WanislltimuladrinkXRha8fen?w?wwwwwwwwwwwwwwwIannoaperhapsOOOOOOOOOOOOO7777777777W773entleaofuleisureKppѾ''iacemPam.ף0engaghimbsorbjHhohsG????????__??(eearhmiabecomeeeplychemesPphila ropy zimprAafellow-.Ȱ,!8ǼǼǼǼǼǼǿǼǽǯO vHxrPonHofass*w1Edw[,intst;pa8Ap`wifmo(made??????????__?cquaXancithrough±ɓcdren Zowaywwwwwwwwwwpkmanldtyle">andnother,earnedarticularsf iristorypatwakeY
associateithoĠ٦Qaim"ftGGGGGGGGGggGstimorsolvupȬ!bvole.''v___________ΕwatchxopportunitXhenfreenflueؽ߽߽߽߽߽߽߽߽߽߾ߐtimulusitju!fhʝQchilȱǽǽǽǽǽǽǽǽǽǾǽƷXthminberaturGradzkinderi>@to spr8^dcawak¿ buW߽߽߽߽߽߽߽߽߽߾߽ߣensibilities??W//"It in,r.Ĺ@a yalkme,aid,R,ne_______Ϻ___^dayȹ[troeloqxcitfeelx,p HGGGGGGGGGggGFmotiveormptȺmation; cyou@ we//reclaiKppo !thinkepcinueHald,??????????__?we8ner--dk xnotnow hbctYme?ɽgggggggize="3"acHCalibri">havetllyeart,r;oneえpreachu(discoursessɁon poorifeHallerears!hatindersouromainingjthis?" "Oodfercy!xclaimedhenhappy , isreopeor? wasestor@toiind,ہ consciousfturning`alth.Lanynehlai(riePinherave knownpatsH??h@hrtxilithong)formayy9,madreamyהדunlo`fugustaenbegPagayoeeEdwarH''''''''''GG''>husbsostber.t8ifǔdivhbackϠdead/////////OO//"t!shhntlaafterquisleep,0wokggggggggggggfr(froHelirium.ӜZxovhhi,mdeemed--y''s(feelmyselQhmadRle.ϺǺǺǺǺǺǺǺǺǺǻǺǺT @4eltehesordstremblweptǺǺǺǺǺǺǺǺǻǺH܄lsoشpaucinued,--GGGGGGGGGggGϾϨɷpisorhbeiresto؁lifeZiʾǾǾǾǾǾǾǾǾǾǾǿǾ">beginn pehnalھ{avior ou utKI׿׾knowó0aЌkfall_ϼ?ϻϻϻϿϻϼϻϨ_GGGGGGGGgGGBButhillraw veilacenichc(ttpowHtoǿǿǿǿǿǿǿǿǿǿǿǿǿpain׽ϾϽ77Pray,Ęas,Saidr..,day, "whoshatine-lookingoung yhmetnrffice(morn?thou eemedfamiliar.CWWWWWWWWWWwwWVϐϏ#Ixsr.oward--a awyerhavetelyaken@to7777777777WW76bus(ssithHGGGGGGGGGGgGG;Strange!mpossible!aidL.|Surycannote̦InknewOOO;Ihlie is,?;Dallas.׶׵g/gWhy,Awaso-deadndxver,o(ago,g''empec7''t;HKso;ewKHrunk0wer;unowromises)noutdWWWWWWWWWwwWWX8hopedfimrdXbTh??wwwwwwwwwwwwIel@cacynentionhitameoou,L.,sﻷ׼׻therendoubtedlyjareYeal'YrfXX:ч'ooooooooooomatHs'اxsiness.nhort,ŒQfe0twayPϿϾXse(ddlesoȅowoЮYwl,stributingracts, formemperanceocieties,ndllhaortftuff."WWWWWWWWWWwwWVϋϊCome,2D0as,aidr..,mil, Iust(arptory, @גב77ߚߚߚߚߚߚߚߚߚߛߚߐ7;Firxc1withe `thisousewoпairretirPHmesticmfor,QbswengravingsAdsicalnstruments.bovell,here)fourappy, healthy-linghildren,ursustudiesrportstɃrndofroom.OOOOOOOOOOooONǐǏAftahp lAyegainedꖀeet___________ךי"Das,ou8a ,aidr..; thfamilyibmȠߡߠ/fewelso.ϥϥϥϥϥϥϥϥϥϦϚ''''''''''G''%Has.veryoulvpfromollutionndH3)him߱߰*reclaimst,hoseune0nityniscl;forWWWWWWWWWwwWWitwrittT0wishshH Anes ''firmamen̆turnQoeous)Pstars׽׽׽׽׽׽׽׽׽׾׆gI//////////O///////+ϽϼϷmbp:pagebreak/>COUSINILLIAM.Ϲ777777777W77'IȞterhpe, @oPillBNewngl,iQ߿"> o1ourpory.Ӭha ydvantrankwealth, ǻǺfaaeacochurcownsheepxغexceedinguchubnce. rx)ppɍ"espectabilitoooooooooo>opuleIabout Bdemeцʚ˔qodmostoncealedmi( forestfpplerees,npringlushIwithpossomand1autumngoldensfruit.Xnearyee0thear,urround0@''''''''''GG''rpicketeP, 0Hallortsmagnific).her`.,ߔߓ?9abaquashin)whichIm uzzoomWWWWWWWWWWwwWVtostowmselves;:ԇ#)full-orbyellowpumpkinxlȓrsatisfiasevenIsuhؚhHjuhadooooooooooonhisrhowerinZsoberly dt Psuperannuat覘ducumخ(enjoy!9aeJatemplpv7geIndixcorndonepg`@ilk`hpecime77tashngteaحramJsummerdarQthXghHwcrimsoP @babuϺϺϺϺϺϺϺϺϺϻϺκt@leQulkylackUڧcowl׻׺ortgarQpiosity.׿׿׿׿׿׿׿׿׿׿׿׿׿ֽBu`pou@fails"Henu llrwealP DoOIsraHTayloH8elflongonecessarylbes,wwwwwwwwwwwvwho,أKemarkab@forothlȽvexusefulfilzupgH(k*sociear erwishassster-in-law,rs.big0EvetjdemIDdB'ifhhas:eins~o`nmehq(seholdWgggg Ychendsophisticat ere0houseog,a(nccumulationofardevolvedlmostntirelynrs.bigail,r,yr??wbounslindveaerpetualiracle.??????????__?>TeldepXXarge,ȝtimisryegi闺irlus//////////OO//arrt8gadyhood0!naMary.Τxwen)peopleesHoma(iiwritteboumho#sylph-likporm`gl@hyeorleas"aertaiOOOOOOOOOooOOinexpressibmffd ()eirahson.{Ha''wfhHmuchndacmєzuplhaiteeth,pJecPPɱ෈o6Hn(ioi࠸collectiwewithseXnxth. XsZngsnsidIegardt yun9mybeaut SHlneXPba ,peaPrϻϺ'y;0hal'ȧstu*magnifiqu@bu纟b0gHtsemblancol픐girl0Rsouass>dozef )oany0rticular`mment--((Xappears,hic0IghڦwЮ(mayشoly0yy/ǺǺǺǺǺǺǺǺǺǻǺǺociaiCt.ccordla0ultlasinw erfectasendayetyfanner,onstantlowkindly feeling,eemednrㆱtoroducllhef(beauty.er~sadustignienoughrepelmpertinenwithouhestroy77carelessreedomsprIэwhichommonlyxdulged.N oP0aerrirunstoxsong8villagraditi,''''''''''GG'& o`oddsenHxcharact formjmaialo/ǡǠanidvpa.Ӡread,o,yȢuf(:''''''''''GG'&Rol 'siyScottFamiPBibleha؆Zglassb(boom[olumhfakspecnP''''''''''GG'hensnovel(borrowfrmew!liafin׻׺Xn9h`Poept)albu8orP)ЮaǺǺǺǺǺǺǺǺǺǻǺwaastahabitut@g 3eretpoetٶ8ϻϺcorn cwHesidesrypget-me-noػr8bud'ϻϺ>memdiffereparticulari,ithnumbohrtl'߻ߺsim0alic:youladih8sixteHqeab߻ߺrddicغsȧ*gtKruveness;ﺏoB,`dayj{'iaB:hz8oooooooooooellows-needleٟowЬeb-foopincushiscoul_______Ϻ____ urnhx.Ȳsewcertainpextraordin8, (weinkGGGGGGGGGggGGoosadehccomplishQXoi;)////////i">stitchingasikeowsfearls,nderross- Mrsbigail)o!acplPealogwifes'gggggggggggffabSy a31gran'r,kevs,marriaz.sexdsAoeXcPwgreat~uncolMX ary ݡ/)'s7777777777WW7ajup'Squi's (؛1burndown.''''''''''''''βnfXл蠹udH (toPall⚰cheW׺׺׺׺׺׺׺׺׻׺״$famicheyaavfromnglP.`it`iOis6oilenominathimDӨxʻ''>eaЙXboard;hadoteȭecȻekڻfontize="3"acHBookmanldtyle">madeundrybservationsnissary,eforeeeterminedoallr svetimlP0Poinkowu/lPPignorant.u*𤀦presentlyDz776xbefriendeav(read/7777777777ǸǸǠOessFrench,oyguzzlXb)tb bǸǸǸǸǸǸǾ7ǸǹWWVcmuconjugatewhe7,orng鸷GGGGGGGGGGGGGThe𒇧dePgoodvicbohcultivon2mi׿OOOOOOOOOOOOO> foGrharacterּQimprovoҠ(g isolidir]hip,ntunȁpM,illiam{qui`Pfavȓr#femalW׺׺׺׺׺׺׺׺׻׺communityenery9dihaɀspgu8himselfغ׺׺׺׺׺׺׺׺׺׻׆ertap icccas,u@delilectu`botan׻׺lsoearnrequ8[urthJuittee, nounce߻ߺ(co8iPglory.Ȼae(know8{toǻǺrpoeta(tiroHtxaXEbehchlibri">thosehoeadulwer'sovels.nhort,tasorallyertain, accordingo (ulesfvidence,hatf臀cnpaynyߌߌߌߌladyt`villageozvisitsxweek, ouhaveonsredOoooosrutyent+im.OOOOOOOO疧Wiamid;or,ike `ytudiouseoplfoundhne///////o/excitemsociety;u8wher}parhorXngsolalkhhom`ithary,cours(st(Ad@mesticne'OOOOOOO8ѱYhbe8marriawelvem h.iPinveraǰǰǰǰǰǰǶǷ''''&ɶinhtabXbftial񇘎 oJonOOOOOOOOhicau𠈪`vy)ale⾨si߾߽>ȑ9feporК2regardq;)y`w߾߽ۙ poOgew׽׼ϻϻϻϻϻϻϿϻϼϻ"Iond 1aylwHaugdosouchUBoa7777777777WW76comy,ap. HȤaltog;tooree߁anڒ/߿߾t `Xdesignsphim=r0rhird}Aotȸ(ce`it}pufp___________??????????_??=Somays21kitengacheaxMrs.bigail,7777777777WW76whacbpؼ)worldӽQXP8athit1WWWWWWWP="3"ace="Calibri">haveoneoureartoodoeer.hillhehoughthowe@hat
<Ȅ_________"Ihinkooo,aidilliam,usingverisompletedork,Ht???????__?>lengthrose,utn pocket,netochool.ggggggggggggߕO(unluckyncrativeness!ow hyh𑁒gs္y???????__?>indorseyeab ofyYesyNVwhee noWWWWWWWwwWWhearwhas@him/77Txnextorn, Calibri肫'__^"Iaveoteenooree;nowhatsndroper ݆׋*doing`yhQt!wasm.wwwwwwwwwwϐϐϐϐϐϐϐϐϐϐϐϐϑ''%Now,honegztoiXadvice,鐺ver0roublesome9OOOOOOOOOOoitsecessitusallednuestion;Mrs.bigail!odf??>herwpin,eltupoAefexit.ר/gg Why,es(ouj,ary;bodyItheillagrxtO/߳O7oodon'resϊϊsayIhlwp׾zIkT,SetortYhladHUCousWXiam׹׹׹׹׹׹׿g׹׺׹dohso//;Wel@})promq@gs8ardiay߿ϿϿϿϿϿϿϿϿϿϿϿϿϬ罧ǽ;Ount!"7ay?sai,`arly8sett׽׽׽׽׽׽׽׽׽׾׽chairehrnessithichuHor*''''''''''GG''''''''''''GG''"Mercyns!:ne8ackhwn9remember//////////OO/.exact aboutt,薘tBixaxfpeakmade |߭߹ǹǹǹǹǹǿGǹǺǹǾ??ߢdo0it andOMfollow7pan> herunt,hoearoundustingheurniture.n3߅߅߅߅߅߅߅߅߆߅߅ل__77777777WW76Mrs.bigail,ikeostb!ateeople3feelatyaveone琿ߑߐto8ar,Pyeeshamedoxack,`okefugenx__77777777WW76generzationonlysertysXhadar0imay8sXsǝǝǝǝǝǝǝǞǝif@idotui žwaysWW////////OO//This consolIofllethod(nichyle!aattof??77_kifo`Prso8pctiimag).fursXxfooooooooonminuteXMardettlصQd8lifmarki`woui''beenany9villacomyfromZhsin߼߻A improbabilitb`Iabsorb0iditsossi;ٸfoment'saleȲ9ǾǽpreprXp og`efirm˚"Mr׽ϽϽϽϽϽϽϽϽϾϽBarthxccasн su12gax[oooooooooooomIXHzevnt,kencoldignifi@air,zstateoical.spo AuAbiXl*elpɸ!vexaddOseloxearnestlyA`߿߾_olJ, ,`,on'up(e׸iameahڸOHenowsouqoroop>
reflectionsnhenstabilityfufriendships,ndesolvingever<torust8negainsox@s0lived[thinkQthatqsas///////OO/.aohollow-heartedorl0togerith Ѐghad///ǓǓǓǓǓǓǔǓeadP┘butCHzsoorciblypent.pw`GGGGGGGggGF0e䓘?fursejdidoish9speakoilliam///ǠǠǠǠǠǠǡǓSX?ae;jfinal@pXPp???????__?>bonnetdeterminXgo aunt'sߦߦ߭wwwwwwwwvnborhooPay,*m9seim ???׳׳׳׳׳׳״׳dir.ϱϱϸggggggggf'''߽߼i apaMr.m,coHgm8iofoungselfnacntahesdursclcess٩"ooooooooooow؋wary ,cfP͌Pgggggggggggg`rkattY??wwwwwwwwwwwwwvA@rgl3k asƼxtt4parlwithwwwwwwwwwwwwwvtw0 hrPsinomnedǿǾǼǼǼǼǼǼǼǼǼǽǼƏwoxi)lussfahڑmqurawaykeadbegHoHof windowyg8lecaupYspeak.ožhawice(quian>after"alth,herewperyoolly,ndaid,-- couhscarcelyelieveisars.eurnedway,ndommenc<Ȇ_________conversationithoungady;Mar tohowha@he1talkfhose,el atoryyher)sinspresentthey777werellnloudugh.WWWϙϘ''"asenuofknickknacks-daidopuncle,oooǣǣǣǣǣǣǤǣjoin!mߢ//߬߬߬߬߬߬߭߬William okt1:n reemIrbetispiritsggggggggg٫hbeg think+næ "!uzzlx WWWϺϹometimesWWWWWWWwwWWWWWWWWWWWWwwWVHeurnwҏaX73Mr.achACoo?????????__??aigbuckwheat--ubjecthich@idrequirxprofound''''''''''GG'hot,桘~Dmograve,otIsaelancholyWWWWWWWWWWwwWWWWWWWWWWWWwwWV"g)hwstrsaalmose//express6iliste9eetails_yϾϾϾϾϾϾϾϾϿϾόEi'noô?;ngggggggϺgggf߾߾߾߾߾߾߾߾߿߾߼"I\hurthiseelpuch,PidQ,lH;'''''''''''"3"ace="Bookmanldtyle">"afterll,easeeneryindoe.ut mighHaveȂ`mebout expectoplenks)f;utquiteirn//youK`7ooooooooooooot;TQѻ9lOWWWWWWWWWWWWWUHerpheymal0oaurnBry amallatchf woods.tasreenndhady,Zenlivenedy ilyhatterboxᆟbr8.hereaossyrunkrXee @llbesidet//////////OO/.maarettyeatohaynttleCespon{sהדsamdown@rougheran⒨Iahiry-lHingGGGGGGGGGGggGFpl0Mar(toppb8ICoocer8ts.ߡߠAfic9@stphyme`؍wa,e77egan:--Ϭϫ''"{,usiXivehnaturalyousso0fǶǶǶǶǶǶǶǶǶǷǣo;ɶhounoyveupposqwthiso.77o׺׺׺׺׺׺׺׺׺׻׺בoiWeAbel(IHknow0is,+@idilliamn''''''''''GG'&toneiresigionϹ׹׹׹׹׹׿?׹׺׹׾//////////OO/ߡOYforgtI cto,usgack"`,wwwwwwwwwwwvpealikАdemingorwith 1g. Dhy͍ beespoQfy (ners`wardsrselfϾϾϾϾϾϾϾϾϾϿύ/s1freer--more--obtr0phePU.Ф𤟔׼eyesla:,"eeݶya easyt¼bubeg8zank, I8xso,sassfymy.GGCdiveight="13"> <Ȅ_________Tohisilliammplyeplied, "Wh8oyou,ary?׊׊׊׊׊׊׋׊׊׊׊׏///////O//-Myunt.WϏϏϔ'''''''G''''''WDidheayɀ0xitrOǚ7Ǟ?wwwwwwwwwO;Yes;nddoo`ouchbjecRringaspnk ,orknowɑрceyselfnÇice;WWWWWWWwwWVw wsoucquaintan8w(confide[that,abovlltаPshoufenway!'/'Iever3so ,s,uietly.ǻǻǻǻǻǻǻǻǻǼǻǻǻǻǻǻǻǻǾǻǼǻǻǻNЊJso/GG/;N).តkmaȬQn.ǼǼǼǼǼǼǼǼǼǼǽǼǼǼǼǼǼǼǼǿǼǼǽǼǼBut-Odӻק,irmly, Au@Abigail pcertlystakenooWWWWWWWWWWwWW;Well,amlad Ǖ{,Hingelipd,ndaze'''''''''''''&br.henupitharmth-0,ousin,oueverusthink so.mrdent,ndexpressyselfreely;utp|ea醇ureshouXQygo thHa0stዙay."77ooooooooooonAa0ыzld,fllappinQdependednt,??Mary?ϜϜϜϜϜϜϜϜϜϝϜϏ''''''''''G''!Shxurnl0@upnis saw trou`conviction. ros`ooȧh`dasake@drawnhthe??armf) ؁!Yfir@easdifficultaa*betwe`m.77oooooooooooo_GGGGESmbp:pagebreak/>THEINISTRATIONFUREPARTEDRIENDSOOOOOOOOOOooOOOOOOOOOOOOooONAEWEAR'SEVERY???????ϼ??__?????????w??_??N8"It aautifulPlief,׼׻'݅}Tvrouiu(eadGGGGGGGGGGggGOAreoingniewlesss׻׺Tspiritsf䋈.//gggggggggggggeWhile:yțtakeanoXrromheanksfifend usefulness,rzcharmedirclefriendshipove,tsoothingtoemembeat"spiritualorgainnicheshrough??pxrty Xs.OOOOOOOOOOooONInarly*,ithurllus,--hpiroices,ϜϜϜϜϜϜϜϜϜϝϜΔer0bysmil--deaIϖare us//////////OO/.xotmisty,"half-fabulous;utsdvancej neߪߩft c`hushedformZissideWWWWWWWWWwwWWфhadowllmos`olitar nhi,#oulaesiitsex`unseenNWWWWWWWWWWwWW:ursu(xanYosxheekvȶwϼϼϼϼϼϼϼϼϼϽϼϱwǺForey,atiH2somespeci(¼Psoy___________^enjoymentBep@Ԇ8uliarharac ɾgggggggggggf;8,atzqno8׆ilgrimmGGGGGGGGGGggGFhimselovassysucqortionooooooooooooѰswXr;poihpqeIHs xxmiɻOOOOOOOOOOooOOjunknؚ9er`i \,i//arnestly(gggggggggggOOOOOOOOOooONOneestmoHimperatcrav@chuh0aǺǺight="13"> itollowstselovedneiyondheeil,shromessuranceat<憗>xytill acareus.ouwirmlyieHthis,OOOOߌߌߌߌߌߍߌbereavemehwlosealfcitterHAserwri''''''GG'Oeautifulhexprit, "Ourrie`noxhy8om;seeWWWWacrossriverfeathPnblueistI,RsmokeQpGGGGGGggGFcottage;pӓxearPalways㔘tingatsi,s 0ǠWWWmad#guardianshipminrXonp0spiifavoIצצצ׭ggggggghh)poeticc .~GGGG׶׶׶׶׶׷׶Bu;n,}?orl ,xich s yopeOOOOOOooOO#natuXhadA,8hp?ɤzhno8ertaintyo7777777777WW7or@potoinbornzpassateavة hire٣ynowledgکnyYqworld,׽׽׽׽׽׽׽׽׽׾׷aɩscenes?llXIXatualϾϽ7tmoHim;8ss;鶡H incseϽϽϽϽϽϽϽϽϾϽύeachhapxentlyseturpose;⨰Kvaguel8ou_ǽǽǽǽǽǽǽǽǾǽnjgeslw)accidalaelligenceЭ׽߾߽out,--//////////OO////////////O//^ $"-lieyXrubxǼǼǼǼǼǼǼǼǼǽNJo'From veihi*rk.;> __________YBut!fllheifferephintsndssertionsQ1Bibleeinkaettern;ialrgumm9`tructedorovae???????__?>mini a deparspirithfor yoctrinhichasWWWϘϗp!d dayғorthodoxy.wwwwwwwwwwwwϡϡϡϡϡϡϢϡϡFirst,1n24d8inctlyaytYrelǣǣǨ??invismwho𗑝YchildX: "AȥPyot߮߮߮߮߮߮߯ߝing=,i@thY/)osyohȴPrDZooooooooosalv2?tsaidlitt`m[irgelo׷׷׼///////OO/Glwabehoзɾ2uraL(heaven.Thؚtooooooooooo8age,rombwordSaviorakH necwiOOOOOOOOOooOO>well-known (di=tim9ulrecogndeagGGGGGGGGGGgGGahidualuardi8;God'sovern8XPixi'?????????__??seemthroughouxoninmete 8nciea008qcnᙿrom,utFicestf8nȴidaptz=purp@`nded.ιeA,bQOwaederflyϺϺϺϺϺϺϺϺϺϻϭbmu񦻦xex8i.ˢ0ledgǺǺǺǺǺǺǺǺǻǺǙxuvxgainab8@wants*wo1Aen--titubdh`-borxertPty)sciousnesmemory;"3"ace="Bookmanldtyle">theeadfllediationustecomeu.stikely, n1at, pa`ߚisHBorrow,tremba 1ympathyith//empts trugglesʟirwؚ0~BPoulwseseul burn)forworkCmH`to8ose//pbacPs9pledgolareparv'oiHld?ϳϹ76''Itਙxfirm8ideaazransfiguoncene--whichemshaveenhtendpurphqo8Bcip׾׽a8impeatPMereihimtϾϽwoearth,ͨKElia"kapp8ȷ!iϽ߾߽yۿxxshc listerusalem.77ʚ@졠(tponwestillhldeep//////////OO/ythyCrzuaffairs--notawprnt,7777777777WW77ulinformaQfuture.ɮinc`쾑''''''''''GG'thassagٮk5Xbeclҿ'pissoluba@t+Christ,embehbod[7777777777WW71yle">fleshndisones.t hnotoeupposedhah`nitoesus withears,eemftenoalkhrougherilsndangers恨ful imminexaserossingohammed'ieryulfX0edgerawnsword,tunhurt?h!ouweɍPattorm,77wheryepgel0nceanotmor,uruesti0wbbswd.ϔϓ''ItayIpblrisometimeakhbecausDivOnqhistcacopolyPomunrl''''''''''GG''Xmidinfirmitihtalterrse.șs,wwwwwwwwwwwvdIedheyuevhˀbodiswscarcenowstself,mh1mpreqs??corpondAP(esi.ԫfaelectrifyhtϿϾfrhild;ynuQvIxAqffivǾǾǾǾǾǾǾǾǾǿǾnjrʍ)nspithituholife;PllǾǾǾǾǾǾǾǾǾǿǙw0eakn؞ult@ڦгcrampfp,illǿǾea0brpfets;henirsruxve,ispuhiedoWWWWWWWWwwWWt,*mayo8lmlyweetIe8inwȨGGGGGGGGGggGGemphtong"9laborforHfula`fitj.~SoPls0generou;whobb1goodqdeplp纗hsh蠩ךxttleisermxanyǻǺn8idjcyѹ1h,thbeliefpen0ve8eldGThinkot,atherrroY,ongaboriHfman,illhyuntands oneesternountains,--thinkota)yay遑isor8Hover.Perhapsikeesu`thouastveduYlife, 燸ύ??experiencHtoecomundчBhim@aviofsq;ꓧǔǓ:beeroughpreparatioburealQkgoodQyull//////////OO/.powafo,yeiginߣߣߣߣߣߣߣߣߣߤߣB a:re spirits (seearth'shoic)pWWWWWWWWWWwwWVwhoso؜snjoymePhmselvexscoriϰϰϰϰϰϰϰϰϰϱϰϨehavea tfailure.rd fromfirst·gggggggggggfaJh0հGFlaidpm!epqnl٘ eJcrush weem+er߽߽߽߽߽߽߽߽߽߾ߍ!mourn@l.ouch,h@ais`iopb/߽߽߽߽߽߽߽߽߾߽>belief!Ԟ;disciplin(4olztask-which瓟r0ȆfittfЀinblboQfut;h;yasatifGcдbHvot7ctingginsfiSudpossessyofǺǺǺǺǺǺǺǺǺǻǺǟq}yea𬊴s0--powe(foQgood.׺׺׺׺׺׺׺׺׺׻׺TuXHlike or,takɻhousϺ">circlP*ainPJκlovedB(aHspotۺys#[becomehisear(erhanllHe livingorld;utnonelinessforrow cheertoinktourst s otholly熸roms!heytimayovebo2//////////OO/homes,heddaround tmospheHPpurityde,ppt0sǓǓǓǓǓǓǓǓǓǔǍ/fXod,Jre ofRevil.׌@casse@bloud7777777777WW76witQ @se artsrobsyHthy Ph eryffortQstruggl!jotsucc.Ƞshou7t`ck\bukefeYun`QHpXens(updmidyf蒘getfullspiua a??QvenPh re--zrisen--~c0neglorifie#yhma!oiistant_______׺___om!erвPprqdarkє9iroicek: "Soeri0so xf tdoubxkwwwwwwwwwwwܳbt0QseenfoundwwwwwwǺwwwww">victobehoeerty1A8.ӹGGGGGGGGGGggG_////.ϻϺχSmbp:pagebr`/>MRS.ND bB.OOOOOOOOOOooONOR,HATHEHINKSBOUTT.///////o//OO/?gggggt="0">Mrs..nd bB.ereext-doorPighbors*intimateriends--that "Soavelways ard,ndhoukpractised,aidrs..; sbut77reallyfateEquestione eeHit.??gwwwwwwwwwwvTXconversaradudigresromisoiH oariousǗחחחחחחחחטחքricspecuxs domc`omyCatstachXdyenO___________h Xput rhildrenbed.פף/ Aortnfter,two)ies8rgainXclRt'teaable,hiXwas9cPby)unusniceingerbH/ߴߴߴߴߴߴߴߴߵߴ߸ǹ777777777WW773Ieouxdvupak(WaAtold7777777'77WW76sooty seǾϾϾϾϾϾϾϾϾϾϿϾϸǽ?;Soɐߏߏbsinthohbeenזi GOOOOOOOOOOoOOo?G;WhA?ﻷ׻ﻷ׻O,۩\eomicaln ,ertI/A;ndif_[necessaryeepsfake/////////OO//theloset,erhapsYwas@stsldǽaPed.t> reasons,lmostveryammaHsitatesboutrauers'oing--thinks.it :gtityhe aseentarted.ߌwwwwwwwwwwv7ϐϐϐϐϐϐϐϐϑϐ"I llyon'tik:sc,+aysrs..; it'soakindfטחSthIpprove0PifcX.`!Zoe:w//,pshousHmyselfgainit.ow,ho Xso龜niceni csancyuch03 asee.m77 surprised #߰wwwwwwwwww7ϴϴϴϴϴϴϴϴϵϴϴAllTime,oornc`ciou|`Paxmilarribula׻GGGGGGGGGggGG׮T1H\disaxeableffaiXo د%A.havealmohaSmyirlh;uG.~__________reJCh׀~ofourstbbhdl/''fhmeoppob仑likcainypfles a??byadieXfcprudenhcre/׹׹׹׹׹׿G׹׹׺׹׹InXnerA.,€ iCDIgoodHtr!throXO//lphabeex,itholefulmenteaؒnspoGGGGGGGGGGgGG@ ng owsDz|proceedwimgGGGGGGGGGGgGGB Qsy9juveniles.ggggggcntize="3"acHCalibri"> sotastomeheartyndrwine.rs..,hoasncorrectly<Ά>stateoave(#icl@t@r{soire,HhtnextonQquotesiscreetG. PpPedentTP.sreaxcPz(this,ecauseaembXofchurch[Mr.//D eadingemperancerator;uYypllo,(noforbeic@sfollows:fashionowwwwwwwwWWWWϪϪϪϪϪϫϪΩN. fromTnuXy,򊠑u)ry@with777777WW76variouppeashurprise߰oooǴǴǴǻ??????__?>&;Well!mooi@tryrestrainyrlsdHgwwwwwwwwwwwv`ravagan0;0'no y!--aworld.WWWWWWWWWWwwW߿ojhmor,haYmatter?xclaimx9{a(esaid,׿׿׿׿׿׿׿׿׿׿׿׿׿delIoar@encouragde`sGdidn'touee K.dauIrsxttћpew׾׽ieaYs Њensibl@(judiciouselТl y ???????w??seeeopyؗq(churchnTs;⑩tcomes箯evident,fo weekir ,be XgottehWwwwwobservation.ӵ0anx1lyrcѫQthjfulﻷ׼׻oneQevXfmportpe(min;mGayWWWWWWWWWWwWWPkapp@l0ndopwith)Pincreasgggggggggggfhorro(f t'_______Ǻ____]Sooeshuttl@cka(award,eptpboPssyos/ϻ//ndsǿInike ne蹐aPdernartyirc matrons@hndify">conclaveamعdegeacy)agewGGGGGGGGGGGGG//////////OO/."These2iҐbeg(ni'cl))two xthre׽WWWWWWWWWWwWWPmorgr1ؽs,aysXt Mrs..,omplacentlyanning herself. (N.. slottpoaveneheeryexteek,ndaseustsefashions.)''___________^"O,readfulW!xclaim,nrchorus,@Mall??????????__?>zFstiffSJ.ggggggggggggߠgaTheyrunhealthy,tsaysF??disturb 8miporderom''___________ak{sleepyʴdaMGǼǻGFlaboriousgetpentireuselessGEQ.;7asamei(coungcrosroompeoplHhsh">invit$w׺WWWWWWWWWWWWWW{Jgenaostdifyastrainfra//////g//OO//reflectionshimprovemX,citfe`ϼϼϼϼϼϼϼϼϼϽϼmoaevilfnform񣘮QworldipAihemptedfeelPcocou8!haveiremarks xnxooooooooooooocirculwe!nompbCcertknowledЩbe0eOOOOOOOOOOooONRer ouachhesePdies0g xsu8aherwwwwwpeight="0">party. h†nkozproperpؤwixou''''''ϺϹsebIcoh(ntJquiteoi@inneirhsp׼׻?޷YggdoHh!p anoHr'WWWWWWWWWWwwWVTon`generYne--Mrs.,€ COOOOOOOOOooOOYhaveosinc`a8ovbnscie٘DkeepofOOOOOOOOOOooO ublic,--saHgoodoPtythusdbGGGGGGGGGGggGrohesomeurdefApxibilitywwwwwwwwwwwϿϿϿϿϿϿϿϿϿϿϿϿϻwgain,ɧاsxoeЮoxҵIwwwwwwwwwwwvcowxbut,mceptasttakضurseoooooooooooopposed proprrLoluOOOOOOOOOOooONetmelts;\t @yxiduoutliPof itsone, andheyos`rsh.''''''''''GG'&~Ye2thXinfluencef ubeingvern--inomeens>God-appointed--aecessaryesultconstitution.ԑ`e~scarcelywpthaarieddwerv`byt,Xtremblyneedlayroachmagnet.ώseiflictwwwwwwwwwwwvwith]maPthdistaX,whenreaaroughЅ+𒉌@{ey2associatXi߰OOOOOOOOOooOOsЋhinvisibicoh.eoellcioofoucpmpPhility+Hmia1or.eȸl0,mos(mportabits cquened߾߾߾߾߾߾߾߾߾߿߾characterpoearnIidu y,nfee纇opinirs.tbpRooi refle:ﺏ">py Ȳ ar"XinqP䭨(ur@纗xmiare yia cedex@ ǻǺ'imh0us.Ih,͜A.0fouinkycou8spe8`yrϾϽlik(hristiayAit0 n@fashpartgowwwwwwwwwwwvward:i twyL,$supp`fq,gggggggggggfwillglfourxampleorrecedent.nd,rs..,fyo thinktoubetterbchildrenobservearlys,nd mhabitth8ssanceiJojuvenile''''''''''GG'&ball@carryutopinionnactiyxiousother,ϔϓwhosfeameu,illuoteasrhie𓧚//////////O//">defe.ǞǞǞǞǞǞǞǞǞǟǞƣ??(u,ngadielet yڣreflect--inhidutfϪϩchahint edth8sweetnxristibHg777777777WW77adornmHa soprincisasselfdoot׷׶doptvefa@pptvogu8whe9su:or??????????__?>--?becomihHbuttttartl variat`??????????__??romeneralmkҽ;show*th2fwXB'//////////O//">|srwro(GG//////////OO/otɚ+#ҚonelseIhaup??8????No+XmoreedioȩXnXcircoYgXby//roerеphrasPq}--allmiPhamterm˜ketestlikiݎer0//nx solicitudpach,kRac!,a(u`q?? Oldtyle">anotherssossible.enuineriginalpinion,venhoughtere soretictosertatennyindaittleo8цangels,8Shakspeareradulleading,oubett//uchuniversDeafcquiescence.דגF//ThesepmarksavHorPrefXȗ sexrincipally,ooooooooooobecaup y dependent,2ex--fromature,nd~habiaitmostxedyswayhby--yeooin0caPyid*artmlawgʌװ߰Hcustom-makPsociety.f0miؙmultipliPschoowhз77dtisesowprongurap,urpo8yeagirlsrythbot0Imoderhx(, playoz(rpǾǽworkhH(upcivilngineesurveooooooooooooinavigaCw)an8hiHcouؒm wo--H OOOOOOOOOOooOohou`ԟmacirwsuaG''wr`ИlHJoos@㻉??e{dୁῨonlctoutt//`body'keH0Ԇ`teperillennium.oooooooooonǾǾǾǾǾǾǾǾǾǿDŽ_ǼǼǼǼƻgggSmbp:pagebreak/>CHRISTMAS;R,HEOODAIRY/div> <ȃ13Q_____________׈"O,ear!hristmassomingnortn,ndaveotohinkpwwwwwwvpresentsveryody!aidouEllen(uarsheeanedlanguidl8ackherhair. +De,t'0edious!ňsOOOOOǝǜgHatbeou@f.+ggggggggggggߦ no,donfid8ialdviser,issestisooone.OOOOOǮǭYou{msuyёgifancy;*whȟshogggggggstore9glit`Ywithll nXspdors,nsurelyaoss经;Wellw,ust컰en.ogQ,erehmamma.רIetwwwwwwwwwwwv)?ȝJi4s.ӻPreer____________casepfourombltwo Xnwrit1desk7777777777WW77diffXpainsHo (brooch boxAQd,`u;nkP@Hpck@Дm.ɾ''''''''''GG'mam/(h,anguidlyaz1onwhitHjewe/׽׽׽׽׽׽׽׽׾׽fers.ϼϻ/wwwwwwwwwwwuThvieweemedapuzzlyadviserʿwhsilencermom`w9En,awn0,esu:--t> givene."ׅׄׄׄׄׄׄׄׄׄׄ։//////////OO/.Well,leanor,aidrunt, 3ifoueallyoaunsophisticate//////////OO//subjectsoractisen,xputinhehyft.showߗߖmoreh`onemiHwhomm!eembeeryoodiry,nWWWWWWWWWWwwWWw0euchifhas2couxAith awʇlikmagicdmרǨ׬;Whppt̕xwhileG7GooooooooooooG;L0pbackey@Y(ose''''''''''GG'&buildings?///////////O/////////////O///T1mrableж`sPties?es'ϺϺϺϺϺϺϺϺϺϻϺϤ;Well,hasealcquaintancesy+n)@eiredChristm,r,anyyind.assu`,ǺǺǺǺǺǺǺǺǺǻǺmaxquitsensation»??ǻil?etsnowGGGGGGGGGGGgGGGG;DoremembpOwen,usto J8roߺߺߺߺߺߺߺߺߺ߻ߺ߶77777771ace="Calibri">"Yes,ememberomethingboutim.S p!f0seemsoagPafm!OOOOOOOOOOoOOjKt idleanoinvoluntarily?Now,a, suppose'shougetpnhristma//////g//OO//mornqfi@xIauphdozenԼ77thAnichapysuch you0Xr!tyeek;n't//thinkmak0nsation?o7777777777W77ooWhy,Itvelikelym;u@hlseب?ّspok7ǿǿǿǿǿǿǿǿ>ofreat y." "Why,idheverellouo?#<φυ___''No;utnea`whenasomingowntairs,8doorfairoomߑߐpartlypen,ndsawedlhereith"ox.ohp''''''GG'&husbxndaittleurp8cap(is聛hichYߞߝregar?mystifie admirPsfn'tuit0ompredWWWWWWwwWVit3trimMaryaztt{longeyes.ǤǤǤǪoooooooǩǮǮǮǮǮǯǮǮǮ'IXinkee9,'XxqϮϮϴwwwwwwww''''ϸϸϸϸϸϹϸϊ O,o}, retfully; 'y@ish!coul@it'Ho?????????>xtty!'___________________________Sayor`aunt.eegoodimustopintowinX___________^xChristmn膠ndeyshall one.owyЀwoHrooooooooooonwhereQcameromalkbou:fornths e!߾''''''''''G''wwWell,An,ntinuedrr, innextreours߼߼߼߼߼߼߼߼߼߽߼miserableuild Qat8XsfiwjgoHtoppover׿awpu`r0tory(nlittroomuybeaves,liv0woor,nely8wn.ԤabotharHo etyXǼǻW:dbeeester.nfmxstantly confinedo herℨwithheumatism;he(r,eakndeebleifailing@pItrembhs,ttersbout,rnly`lper;yreentire@dependxharity."ooooooooooonǖǖǖǖǖǖǖǖǖǗǖƈCan'tdoy? nit?[aidleanor.7777777777WW7ϡϓYouYoustrong,,haveuickye(ni؛/??g;ow(ouiak"Baifocks䮧ǯǮ??I. Whandea!evtried,utkcge//donenweek, haps''WWWWWWWWWWwWW';Aiomebody硡wy-fi cPsohemPIsqhadHo8 payoom򾰨buyalʪXrxھ׿׾oiamp-wwwwwwwwwwwwStop0uipity'ske!׾Well,pwillap;ban't:cmustso`ch 񀸿hӷHmiserablehlin, beurnen xreet.he߾߾߾߾߾߾߾߾߾߿߾meȬAflц)iqersonendsoesXfꍹas____________d9!o(rs37ymore1starve;BisowGGDiveight="13"> scarcend胸riced.""Ount,hatismalicture!# "No,eally,on'thinkheareduchboutt;@Iadoive>χφheromeg,ecausebsem`eearXfore,ndɆ?????????__?>didotaЋdaltryrePonen rircumstances.K/דדדדדדדדהד֑/////////OO//*Then,lla,saHan8oor,istsed,ufferctur7ߞߞߞߞߞߞߞߞߟߞwhoeedsse#ow py msfooBmillggggggggggfapp .hatJhar(colXglittc,0n cheersbody,?熇(mean\you ̀mustakesͫײ~ySm),frokenpȥm@ I٦rmGGtfeltadnroughaj*ldwellbϿwwwwwwwwwwwwvnc׽׻ǻǻǻǻǻǻǻǻǻǼǻǰ;YareettibeAorataunt;uton'pro0ofϼϻChrmas entamofriXs equals?ϽGGGGGGGGGGgGGϺYeind,;aid@r,ndst(rd. I(Phaom_wwwwwwwwwww_]dmorofood--a lЩrkrinstance Chtmasorn.ohn耐c(rived,y houfxtraorkveryn,layenoughgetarPew㉈coress;he,oor''soul,rbargainedwؒXPlIinjewellH~possbe0iduthatorim.OOOOOOOOOOooONǞǝ"InowYo,warwowho `p,Xmeoy--atieng0le___________^litellow---nuiethweekm0hshiHcribذPmHgoIAsplend`pЍP.{DzDZ__YWipray???????????_??A)porange!on't`.ӲwillhHecsit;!ǿǿǿǿǿǿǿǿǿǿǿǿǿihanoofourom8Ds,`ickPLa@yǿǿǿǿǿǿǿǿǿǿǿǿǿbestK!zyp8bӧey aime,Ұh῿J;nobodysHich[happiYWi?''wR.hreu8׭Լsɴkeqthink--gift׻׻׻׻׻׻׻׻׼׻י fromov8dLproduce;yęɍropriatday7777777׿׺77W7777;Bd:ȕttt's򾱯thov\givexpens~,@pposaalwayxqsap8yzQnzǽǽǽǿ/div> realffection?""Ouravior's,ertainly,unt.# Autcastdistressed;ifhrhouh@hackrggggggggitymЍ,re whinkmoȓo籏9charact(xfiim?׌bearryingplHgiftGGGGGGϲGdwellporGlid9abycheerl s߸߸߸߸߸߸߽g߾desolxkforsakeQsorrowful?????????????????????????????9 onve@ti0ed. *WWwwwwww׿׺wwwwtWhaortѴ'pe Ellau4aCousTom@7ϻϺ)waihHeda@rt-lPpackag@whichdenust׻׺ruX!tǾǽ2Let'spPit,ducyill. Up8myrdworegraylanke_77shawls!h@oum! w'shis?reatolt ofottonlannelndXayarntockings!"߅߅߅߅߅߅߅߅߅߆߅ފ7777777777WW76Theoorellanggain,rtwaiteroun@oȁulkyparceldeposdt Qmarble-toppcentrea.ǖǖǖǖǖǖǖǖǖǗǐ?What'sre?[aidilhcutt0Zcord. ew!erfectesHf//ackages!oloea`!Ppwhugar!lesse,llausbeojoousekeepGGGGGGGGGGgGG/;OrcrazyCTom;myX,wd,0aou_gggggggggggg`Bindow, ea乐r`IPour,th(`vsOOOOOOOOOooOeakettleڵHϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϿϮ;1ch-csel;j)thiPom8'77youlady dL((cefully rd.7777777o77WW7gogN9boys, XroadƣexclaimasachQmischiev_sxsvemarpup(nttiȣa1yawlǻ''''''W''GG'''"Didn'tgxmors?׭houdi!bothON,a鬰khcottonlannel,k0epairh>

`taloons,"aidom. toqwithim?&2//gggggggggggfO,now!goooooooooooogǒǒǒǒǒǒǒǒǒǓǒljgYou[hencguesT,@some1yourharitablks.~are; makeuveniLadyo0ifulEl,hϟןןןןןןןןןנןךϤ//////////O//*,hoadoloredrootsherir exposԪverynfashionBChristmasreparatбp0(okarpandestowed//////////OO/.a gent)saluta@litcuff﷋saucyAstill9eǷǷǷǷǷǷǷǷǷǸǷǼpurpapӽpnstengarrouurseϾGGGGGGGGGggGG';Laughway,Ñihe,yly; aodhnysl),,???????'??__?>ose@s.gompeo--t notwwwwwwwwwwwvihab@·!/G/GWelw2IeenitWdtouY(kἯ缯Ͻϼ!ideP.Լ8 ldmoneyd(isime׼׼׼׼׼׼׼׼׼׽ׯyP, ptt[nobodQntqcsor׽׼ftCy;ImlaXyart0isoYaJety)Jline;@0houXli89ivX8ibri">thesetrayeavesoelpn,"aid,roppingenollarotento heraper. +Iikeencourageirlthinkfomeigesides?____^breastsndugcXy.CWWWWWWWWBut oryon0oong.fyodyantse`heesulofE'sirstttempatood`iryism, y0lldooroooooooo////)wor0robuild@RChristmasorn,shhe0ǪǪǪǪaboit.Ggggg____mbp:pIk/>EARTHLYAREEAVENDISCIPLINEǵggggggg'''''_ߺ߹Ǿ7ھCWhouXse y2t ,ǽǽǽǽǽǽǽǽǽǾǸgM_T ,ndeed,гte0?ggggggggggggO{amɹus k#died--ransom?CǽWWWWWWWWWWwWWUNothjbquentlyeltspokenf@s deceA??????????__?>inwardifeevotion,ྀ +Q;SjevXupojgggggggggggggfwIouro0himsel)wor@Hthornso~hthuYitecomethnfruitfule="3"ace="Bookmanldtyle">Andet,fhis aecessaryinevitableesultforldlyare, {lings.׼׻/wwwwwwwwwww/trumuloosalkbou`nrulxrov@;ٹ繇yet,airted K"`yhristianغbewwwwwwwwwwvth`ex)sed:harganseHperationa(0Glawɋtterwork artH( ҥJWWWWWWWWWWwwWV陨 8exercishj9uvisa,ooooooooooooll;afqȯriqfqcounselgggggggggggg">hownilla?e, :(ggggggggggBookmanldtyle">togetheroroodohose0atoveod.uthenomeimple-minded, incredulitXitaXukY"brodisplaysore//////////OO/feelingiuposophy.ǘǘǘǘǘǘǘǘǘǙǟN??Qas ʣry Pividual!madepXractionȗputgatoms--sXichaffectabicha0''''''''''GG'rrecurr,cةpasaefropoDZǰ.wЩxeralXlinefficijcecrat@''''''''''GG'rea˷0todyw{Ȇ`t( thϾϽn:exp.noyearso)ɽǾǽ s릐hvoi yLordpeaPoim.hen'' dPhlainsild, 9bolhtrikdow 77brobys,9n@ePD!drawnP;l`e0humbкѠinwa shximean׻׺Xn8Ciscipl0ۍsxnpeseociw">whol thproxtyAswep`way,--e[aoor__________^ЅevXyyes,ssusufmagnituavewwwwwww׺wwwvfrom𭈅-a0sign;u(sm Htsooooooo׺oooreemov)Elosses arencountered,ndheetty,very-day vexationsjannoyancesfifresboutim,ecognsood,hearvoiceKse{design.ȍXeohnewtonays, "Man??????????__??Christianwholo`ahiloÇ0trucـllϔϓiroperwithJmos0er ortitudItirel7777777777WW77vanquishedHcomeybreakingKdHFblundeh!ǠǠǠǠǠǠǠǠǠǡǠserthowoncapirithatetHwotWWWWWWWWWWwwWhem.''___________^Soen(sl0erΰuPhuqinjuAs7oYvily a asoIEcharacOOOOOOOOOOooONhisemporalHmscx vOOOOOOOOOOooONhQq*)GoougveilOagie !in''ime-honorwordoay,--ϻϻϻϻϻϻϻϻϻϼϣwν Wm0piteainstoin,'They迱sA;2Zhine/ooooooooooooo/7777777777W772ButmerRfault-findingpichhetver!e`l(daacours:lif໹o8rdmarkimplieoǺǺǺǺǺǺǺǺǻǺcensurooetty,8rhapbenokbpurr''sxcesdisquietudunpЎ@notferi's providence,oronsredsartfis `bationndiscipline.Thosehous)vexshichmepus0roughpeunreasonableness,arelpvari0titualpigs,/////////OO/.ill-adaptedor0oureculitiecharacter,orm7ךיveryargetem )quietudlife;jyetowfewX?????????__?>beyoQhuagent,Jfeel!(rialm8romod!etGǦǦǦǦǦǦǦǦǧǦit truin y sezatsollhhϭ____________">gxӆφȡ:only׀/oOϳϳϳϳϳϳϳϳϴϳέJ`doti`Xr+inidu0yyY׺WWWWWWWWWwwWDz8sxifi0Xign, "XirfflicR'h'thTﺏdusDtЇr9tgxnd;SȜ0HR??????????__?>xievВnovpr8ncPai`bbor`alo1a''''''''''GG'&spiÙp!` ȼ ٌs//>c taersQ9hxer9steadhorale.?????????????>Hoo,8coldnesalityw8eIQJin77777777777776prayer:t褀aheztr,7777777777777Ǹhaveillsoul(ullhثroomony;GGGGGGGGGGGGGFelshnsiӔ(myȹ8towi?????????????a裢sy˲I8, thehristioffersxisrayerorhingshichksQouhoant,ndakesoentio XoseWdoes.ersHawGodoupourhtspirit hea8nconvertworldRbuikdom兠yere,9nerhapsᓨoleefittle//anxieties\vexa ro0ractXPs, hardlynowsesay:faithleservswaȋ|proty;cblunder Ispoiledlogoods:haXduunrul:frie8mad!omis//////////O//">(Qkeepm(ncquaintanc*unjusr8t@calremarksomeewurnitu damagruin0bynpi,ePd;0allP)roubformZsubjecttter׺)er,ܹغPiexkXeaXfrtHdown,iJЭpowhexh`taany纏helse.“Peo0`ideg)ul's@milia׺ ,+every@I0r,rea nغ纏bo;felt[\nsmXefpfe'ggggggߺgggg1p[tpermihimPpecific_______׺___^goPpurpose,wuchoXwhe8b2!A~constantdailyybec()settcЧhetmospherefheoul!owtightisposendayw(many anxietieshich takepirl1re,hatc0errat(! @xa90t0spp߾??????????_??8amusem ano;[snworbreȝinyooooooooooononexcit1r`temptuousitWhom,n,hOOOONsoulurno?hoilleehatefflictionhicha(spirit QYw8Xupp s;?rhiwhichGGGGGGGGGGggGFmHntari LȅappresYrl4gggggggggggftemptw8nab`ssurmount.eear@oڴRW/////////////nfhiȅ:YmorfPerll׺lssn zpeH,inc(ߺcePral stI; seo8yA,(nhangYsitu,rsewwwwwww׺www'rou,8omlaesxorrHosmwڎ!yغwwwwwwwralibri">depths,hatesquallyresent,ndgraciousidwy morelearlyndistinctxth`Jesushrastatedtlready.ot.a rrowlletho`erouwithouturarnefQms'''''''''GG'&forgottenyim;Jwe"valuey%s;ea,ven'ߔߓyhairsIhPumberedtibeliefnQse77declarations, irliteralense,(comesjcalmsettledǡǠhab[ouls`fe9r eem fromrudgerryo''empxesئmadeu Pinest,eaning# gnificance.noPsvell antIwcHgX??vex min`espir@@achQh(le`buǻǺcertaPagency,itXh@yperfecpp@G????????__??'7W77mbp:pbk/>CONVERSATION ON׹'ϺϹ'''Fr"FXyydleordathnh(,ygiveccoun'%re"2dayjXt.GGGGGGGGGGggGw/ A solemermon,aidiss.,akɭheadmpsXlasgggggggϺgggfs`s dowoabonun!noon;nYaeepXghYeGGGGGGGGGggGFadded, {Imfrٞ:ifesybeendPd[(ourǺ׻׺fs,omeeopleillavereatealonsweror." cousin,eallyhinktsreezing9essittstillnd haveouchbject.rehese,9n,dleords?"77ooooooooooonWhy,!txactly,epliediss.; {inomeasest necessarywwwwwwwwwwwvtHaybthing,`Pappearude.GWWWWWWWWWWwWWGϛGVeryellherncle.Youdmittha:s,whiXainstructi80mselv0considered,rbeidX77keeppptercoursefcietyg׮/;Certainly;׽??????????_??ײҡipwbentionbyelwworXreeeopleϽϽϽϽϽϽϽϽϽϾϡOith@om8diffdegsAimacyll`on,ɿ߸k)s`rfesڦalk)rondOOOOOOOOOOOOONCanabirdvbonnetatXnl,Yany`绯ϼϻGinPfAkmaBhversaA.tmounts{eWWWWWWWWWWwwWV'goodorn,'Rorurtesiһ??????????__?>ehsortmq n instructivi yet//////////OO/.it esefulSq*˔mtab`asy,OOOOOOOOOOooONpromo Ialeelq;BnnocYmeansceinP\ (despised.cOOOHght="13"> <ȃ________>"Butshereotreatangerfecoming숉ndriflifneallowqis?aidiss.,oubtfully.____בא/Toure;ܑ alwaysunneverynnocePxtoggggߜߛexcess.neB)to ,rrink;e:ᗰםםםע//////OO/.RbothseIir H.owurvelyou8friewGGG>Helen,re,perhaps!someempthon rbasǪǪǪǯ??f`X,nna,ɘkmo@aؔ@treme.7777絏AwhatDϺϺϺϿ''''''''''''''''''''''''!O8straiPr@Xby peavoeepponstant,ixe?????????????teseriousn!Xlemnity,z走lowselerelaxne1a`prevtshalthne.ɨ rd bg?????????__??<,xymustaHvatyJanifwoulOOOOOOOOOOooOOsitown xleaH躡a(4jos1@ooooooooooonQJ#0ulgJaoodaughμy r,zٻooooooooooonBonlyphappip1bu0HttChristian_______________;Mncle,aidiB., H0ёѲp9Ibeen''''''''''GG'&mojguardgainst;aneverelltories,raughndoke, withouteelingondemneditfterwards."GGGGGGGGGGggGFBut,year,ouustohe inkestimonyfoodߑߐ8scienceePej`topyurpose.ه]makepr??????????__?>mithatheerfulrentܝsation--wonh0מםfirobjectszPe--h@itsl`,I??n铵winotjurbycwwwwwwwwwwwwϮϮϮϮϮϮϮϮϮϯϮϤ藸@esdo,ncle?߸߸߸߸߸߸߸߸߸߹߸߮DoBYoXnm80coldnessگkzrgious׿Cs?lifelwaഀi;Yesl7777777777W77/;Well,@߼ДOhesulrforc "QWWWWWWWWWWwwWoneethou].٢beȶorut--}~exhausted--psionnsueNowpuީ(rom׽׼'hesubjectsivertIbyheerful*anima8n0sat,洉willhrHwhile0re8mthewڿenergy7''> "Butreotoolishalkingndestaexpressly0rbidden?<___Thatext,fouillp heonnections,oes\)גבinabstract;-onmmodubjs--which*often??Hignated NewԗameHbyphraseologpemployed.ɗshougivesenst--neiilthin`,,77indelic Zs.ԙdspraamusversaoǬǫ[Ieferred,` omie,!anyea at77proptimipls.ǰǰǰǷ_________ǵ׻YeteoplHeakYgayetxssistChrhi8--evGǻǻǻǻǻǻǻǻǼǻ>world(,aMiss.׼׼׼׼׼׼׼׼׼׽אooooooooooooookbecause,Mfir(,yLhawropide8PﺧǻǺatgi`requir"isxctp0suppo8xǺǺǺǺǺǺǺǺǺǻǺviolhпirwn nci0ulgit.Ɏ3se`ĺ׺׺׺׺׺׺׺׺׺׻׺דre somialImyouHho`alki߻ߺoay--withm[kЪXs0opsramm@uߺߺߺߺߺߺߺߺߺ߻ߺaHbit--givmp0st)hinkprious)ll??ButɅC ifrs Jre`s(edyJder??affHatbeol)spirit1tPreguH9/font>

temperndrongueyt,inllactionshowvidentwasoteprovingnyodyorriflconversationtheime;ut andardeeling, lossfacterreheesult.oupokedlyitsrue,uteverlYxdaponsibleyo0oXllY//////////OO/.c0equence0rords.oroforr@giontenak_unguxemarksbo0eachr,hihleadbserooubtߚ'@tf;*xy“Ge yuexcite.Пnt ian(owmselvspeakfa3w;irinissnp Y ild08ngpeople--Zdo thouqly--sdestro8nflm1wisave(҆ul7o;O iPڻ*ivat`dfastidiouX com؀)fromurch,oooooooooooiritic monnfoiY𙠨ϠͺϺnmaysmad1{er"ims0.צeﺏsHldupbarramsettaudicrH纏ivieaigu8,rhapervaXbeh@ chair,ﺏ aplmostsu0oChrxi8byatdiscourse,ixYpurposlosqectʍ4 XwwwwwwwwwwvsӹIevisonQAadidD,wwwwwwwwww{"77777777777776 v> "Ihink,saidelen, thatre@dealfvilsoneohildrennsay,yurot{ing9wwerey./////?????__?>eemsmeϑMiss.ߑ،*viewthHubjecillooooo~reducesipalmossuchAo8r.ow!ever@estimatconsequ:irords,eopl#affed8anydi(ayszam)??gggggwwwwwwwwIppospncleonlyespib forHultsgggggwwwwwwv(cPfulne@andfl`ion9mAavRe0n. xHц-judgpLbu"dx@be --ooooooooooonutthithoPidera`all,prox9ba9zhf׼׼׼׼׼׼׼׼׼׽דrsreyxiodojmis*x bayezw0abAqay0iquiaȡ .ϾBut,ewʪsrofreedom___________^v»[Hel??W?foualklovxfriend,c,aus׼׻/nstin!avoHٴ껫paink󑬻_߿߿߿߿߿߿߿߿߿߿߿߿ߡ_9Certainly."
h`estlowfnimalpiritsou`neverurryure-mindedersonosa0ny Alicaterross;0dȌeame ner,''''''''''GG'&abituallyhristi8s thoufeng,wibebleitrksoPwatchfulnessvoidhat(yinjurious7777777777WW76zmoxunrrain(consation."77ooooo/mbp:pagebreak/>HOWOENOW?7777777777WW7'Itxssplend@room.ichurtsweptow9`Xi?????????__??gr(oldsalfxclud)Il,shedinofte/////////OO//ok ht0wxXavbroadirror??t reflecغtastepaccomplishy:hfealth. s,??????????__?`ra9cly,rround,ryrmgorge/">biHgil[amom,litternrnamenlayỗmagnificible--aKoeautiiitppoi؁showyo׽׽׽׺ߺ߾ߺ߿7777al,yhaveeneaHbeadwhvisit8XuHtakepai"Wadition!at߾߾߾߾߾߾߾߾߾߿߾superb ds!nBZag.O77ooooooooooonAr)ouseasoungingnofa,okverlate review--forȆ*a !ofeisure,ast8andead--buthensto%ible!--that (ms,eupposnoartyhόόόόόόόόόύόpretensionsaetters.Ԇ--certainlycideredtgggggggggggfyspecta--ainimeancie li`at(8nߚߙadmir&imoral cepts;  its Yori0,PWWWWWWWWWWwwWVhadptxactXmadeisind:mer ppeastrangeᦷקצin2H!son--ors(repvoltb+R:ruOOOOOOOOOooOOe!studiantively,euchzgenlmsbout8|wholou`Iwellnp77keeplegacopydrawroom`.So@``ic.owaGGGGGGGGGggGG''Cwithsnt(thdarklle0pٻlQruis''''''''''GG'&stairs.ɡ@n9j؆sn(mzdrpr??cicesipoh,1thaXfulpav'''''''''GG''stopp8xmpapcl(.®ДRn,R''''''''''GG's-cold--1 npseewecaybrڵhearth,gggggggggggfwhijsorrowywotr*Hk0 eaDoouwwwwwwwwwwweɘpale,iinirl0 largxeyewhoH׻׻׻׻׻׻׻׻Calibri">crouchingoearerot8?--hark!8owheoughs!΀listen. makenyorei(to-night." wxway2life.ndethatanheo?ooroul! how yimesascalculatedllrittleerces,oeef dayctagmedicine`Mary--a!inain.he//knowsily&,as0fhir,:warmth)ave;bu蘠ד"theseHingsre@ofuestionh/7777777777W771feelo oxrR,ecHoncosy,ppyߡߠlboyecomlQanxioutful;"ev(R/777777777WW77>tQmost,onhstopsworkmenstrokisKQheekLksaaugafell'''''''''GG''>BwaihAnoAhearoproqim+isP(׻׺8toilwihapcabyapGhiver[ungrsidHwhomz'stitific`can`ǻǺalwayseepiet;HrlastieP`"whichǺ cufrhsho!1üXftR8furnishHremoney;0Hreadyoȓ u own d@g ǻǺpspectsup.BHye(wox8|,KxirNay,ouyvenesuffyplikee[whe!t?ɸlltellϻϻϻϻ"0"> "But,other,aysittleenry, cwon'todendsomethingoat ,r rinkeiefnxiomind.ƁyourϗϖFarknow@hav(eed)Xses.'ǜǜǜǜǜǜǜǜǜǝǣ?aifis k,doves,77doxlet@soofor߭׭߲/;NayǨߨ;YdearordesChrisas zXwe''are۾certainlyJdim.7Wh0[o__7777777777W77_;Yes,hildren;emembhowAsaid, 'TSonh(h7toay)ad.'pitellrq@oncRt,hungryhen)nonoiveod߾WǾWWWWWWWWwWW׻;O.2shouweitxBible< Mary.ϼNow,f"richً odyetdemiHthink//////////OO/,vispooro*Iaskr@W/div> groundedreliefftsruth,hatoushenswer?Àgive<13/t)rgumen(fromiraclesdrophecycforll '''''GG'&changwhichh@aveakenlnȎgh@latoroopyists,mAweaenuinYdncorruptversion?ot??!uow,n,opyknowie?ȁQsayour߅ޟhaarmifeloodheartƠ77rHu@a0ing aisunsSP"n_wwwwwww> ess--Ehem;2xlike xner0it?????ϳϳϳϳϴϓ?eeвnsciousnes1PcertaordsYBiblA׳׳׳׳׺ggggggg"!.sbyeasoninfryenchild,w@wooooooߺooooXark,$imoa'soicNo!r (only ggggggg׺ggg'orlorn2dr huÚ;هggggggggggfSavio蟊till.gggggggggggggf/////ϼϻςmbp:pagebk/>WHICHSHEIBERALAN?ϾϾϾϾϾϾϾϾϾϿόwǼϺ߿ߺItasam`utifulummxmXh[ilitttownVߺߺߺߺߺߺߺߺ߻ߺ߆livllhurryioallege(Hnce(t.үP׺׺׺׺׺׺׺׺׺׻׺ֿcarri`s蹱)ruraets;groupsYwell-dauditorsrhrongto+qHexhibition.llasayetynd animation.υτ''Andmonghemahat(arteYxerithoperfieggggggggggggambiYX((tfamesxanton?oung,uoy,repossessi(inperspynp,bthisay,ц9sence)world,ooooooooooontoarryfstalmascholarshipɇ)institu,toreceive, e(@ dьgrSJutmoyouthful%c@askforetntrarenaZctualife.idos777ulselutick,e؁!mselhnncOϷ϶>crowdexouealedictoriP4P?sawg׽777777777WW77>mefai ſڧruddyhildhooHsobcalculnganQike8ndushe(ruriositXlist0H/ߺߺߺߺߺߺߺߺߺ߻ߺ">Xds?γd?4rioȵ auKleam@!far'sy0whwa(staff@ithQterevedockllab Tc@#xoiceǺߺߺߺߺߺߺߺߺߺ߻ߺ߭ride--*irborn?haseқ1ts|׺׺׺׺׺׺׺׺׺׻ק'oW8sCrapar (up|y чhhe߻ߺ `triumph!׺H, lconfPop;en'׻׺fie8lif19r'setnsodyCust߻ߺ'combat provturoIimfie7 height="13">

andromisesnoth耰s,hat erriumpho8lifeiveoresh,<憗>ull,repleteiope joy?ӅeltamStantonhisay??whenard facongratulated havingnfuch;ϔϓo(men,(verfo@alents:worth8hDim,A7777777WW76badimarmlyodpeXurse;؎xHycast///ߡߠglanc(favor`ommfait(w per頿OOOOOOOooOOdmihion.oooǩǩǰWWWWWWWwwWV"YHAesignդbaHIhust,aidvenerableudge̋G??????__??torد8tmXcetinP. IPeldseengggurZmiHbetthfi88Ҥ9legalfYG>Xvoice!j!tgXszsiIQphesyhwilloutdoll.ϼϼϼϼϼϼϼϼϼϽϤȹФ0was+X'saringbynhoSdJٺǻǺnoftsormlyll th.ɺ`pIanyouhttobequickPhhcts.onot,ealth,olitiؼOOOOOOO߼OOooOWmb1ȯ9moffmves grasp;utoereggggggggggg ,syuderetir:tn)prayi>f-exa Taی@duate0dw(1ah ׾׽deny;if(yistoonversation,fewveningsfter commence(t,ithlassmateehallearnorefhecretgggggggggggfwork*hisind.gggggggggggfߐߏ"Ando,`anthaideorgeennoxompsyty9iwwwwwwwwwwww influencesscom8doecureourف@s--pray,ootsethingsem ikerovidentialndicatioa:awsb'''''''''GG''f腀?es@s,Xiseewngl9Statqministryߔߓsverflowedlready--Sersnoughtoo ifnayꚱOOOOOOOOOOooONbynumberapplntsorxynoccupipl."N`3eJammy[Ѥ.nowallccouYargtrue!9e'1!Wenwwwwwwwwwww礊Ie0go;APitobleѼsntemxtehtisacrifiof??talX((ntli(aYsci8//capabiiekrefinsotasybuqselfaog(b in''1 newr?ٓwinye1recih@;ϻϻϻϻϻϻϻϻϻϼϻϻprivatqsS klyisregardedқB/77l`th astmoHuucsectar෹reXoOOOOOOOOOOooONthinkllos/ϼϼϼϼϼϼϼϼϼϽϼϱ/Ǻ/;Who, n,a?pplipJam _____________3`menmilessY seooaings--n<,__Y> substantial,ackwoodsurniturenrinds,hoillotGGGGGGGGgGGAappreciate,ndfourseAee@`arefinements׌׌׌׌׌׌׍׌comforwhichouusacrifice."///oooooooonǖǖǖǖǖǖǗǖƈAPa(XenoughuxadyohetHrgenciesɒ________^westernorld,oat@seedePupon?#8pliJames.ǝǝǤ''G"Mp classrspeakImayotn;ut,Pfwww׫תef ItamecP`kelt`go????????__?>Mthoonly1drd (0ligious prisбpmy___involvɪgDϼϼϼϼϼϼϽϪggAW2qmyart,R, IrIwingy`an___________thҪqisduty;evcoufeel@LrurOOOOOOOOOooOOmyselfawatemostumpslogpbins.yiwRɾtou`,Xssemulsoaha`been___________^accomo, hnPwnxmpletelycue؎bodndGGGGGGGGGGggGn.G____________G/////////O//GIfou[sxJameޫ)workreϺϺϺϺϺϺϺϺϺϻϺΨdonanotexciteme`enoughyaens??absencfll,--ibupAPistr𸰾____"> savingfusouls,sothenell-absorbipurpose,nd<ȅ13________[desirmp@f"wholeeX,--noeooespreach:gospelPerȀ2+hbutl1painedy77777it."בבבבט/////OO/./////Well,anton,eplixfterauksomeeriousness,______ߏIansayatav tt{yet.don'tnow2IIǣǣǣǣǪ??HbrouiPqȝsePustonfso.׫OOOOODZǰoushstat8employmwhiwemoral77fortitudzsHll跀h, (yself,makWWWWWwwWVhpectablӅIt Yllaw,ncd`?tcircumHnc8youhoose.owevIPZrwwwwwwwwwwwWeelhsalyi@T;sha+m??????????_??Aewaysppsatios`hfriendsrt`i?s9alestin s--n*al,ھhologic`semXry.ǼǼǼǼǼǼǼǼǼǽǖv *WWǻǻǻǻǻǻǻǻǻǼǻǢ߹߹߹߹߹߾߹ߺ߹߹ItayOHaiddle-ag,fomewȹϺBookmanldtyle">threadbareppearancXndestrictedravellingonvenie0s,aseen settledoads,mongopulationfisorgandndeterogeneous povertxacol#hysicaltigu+daibeen`miliar ndϭϭϭϭϭϴ????__?'eoehiclhou(ptmidepthʢIfst, itgggggg׺׺׺׻ד0imptbevguidxr1\walkHes*R,hudraixxprea9wif`nXlxhealth{ayou)grow@$moeiftydollarspswhopamPtqmHat*p0)hisnds;//)_̟Ʌsupporcomisconnec//tributionsromژnoPrpeople.Ȯ#livw@ou7bsewperexc`iDfxZmy㚸ce׻׺snatchbre,[1]JfelPsoircumst9d canϻϺfeeldifficulty"t৉Pell8ualigorrgy(efaallostimulantxoich IivȺqhaQ_______Ϻ___avorabؒ7cmu8eb.ttimehatesow introducedo8eeader,qhadeencentlyastornnefmostmportaAettlemsstate,ndmongoseho,ors//////////OO/.worldcircumncesereo`rned,ablpoffordim~compet`up.ut4munitilikДwestrd77@xpress y-makipurps[byGve yeargtauzloo󅘙scarcebegu feelduty''''''''''GG'&giinistoweveraboriou(eloqu! suchsful,߮߭'ayȚHsebmbarrassí popty.ooi'OOOOOOOOOooOOhsalarygardascharityichrptrenchǺǺǺǺǺǺǺǺǺǻǺsuit y`erg timfamiآ endituPat׻׺'ithjeal censye.[Footnote 1:Զparticu`sӗPhPtatperal1??UrieؗjdevdBOhio.]''gOлoxP,eoennox,awyadytalBǻǻǻǻǻǻǻǻǻǼǻefficylymselftdprof@ionwarizingncombrou X:forclXlifeinch.ȤXmemb|Chrixchur 9Hveirreableonduct.romaaloooooooonri">generosityfispiion,econdedyrinciple,easiberal ofheirariouslassmates.

__________"AndolsopsnAen,#aidr.hanton. Strange!enotggggggggggatllxpectt him.utoounownyingGeorge sh?7WWWWWWWWWWwWO,esErepliedoxr;Lwe(ierc8ileife,gggggggggIardaurnaulationorthrt!Ȇh--(hrewdףףףףףףףףףפfellow.ɘwaysewwou8mak8-ld./''''''''''G'_''whxhasecomf̨don7//////////O/g//1do1wX;professorlpuage:-olleg#?????????????ߡڡstelssu Lnramm(tч8misȩhaveuiteooooooooooooung'''''''''''''縏;A`Smiths׽Ͻߺ߲]ڻoffice `Washhtonhereiv1(great''''''''''GG'&sYlastiHIa@imOOOOOOOOOoOOOǾtayestionPwheministhsank1sleepnmi'777777ǻ77WW77anyomfortabxvisshfriend'shamber, ougggggggggggrebukԅѷtxce輈rȽ@reИѸ"dur??????0">''"Bookmanldtyle">backnllheonors,ndistinctioncomfortshichayround onshnctemember9t1Be٨eh⧷777777ǴǴǴǵǴ">perf(hwXchoosworld(condi,sPwn///OO/ccordeeiȵhsers!dhrP??sentto`)ckeʁhiof//////////OO/.itmofollBueistoopo non:b7߻ߺ;Rinxtstנ+say, CIp@or$yavioغGod.friends parteornskpAwarmlxpromisedequ pnewalirsumirHrse.Α`Ѹ bill r׽׽׽׽׽׽׽׽׽׾׽twxarsYrminfouX0)xXǽǽǽǽǽǽǽǽǾǽ>unheptabledpleasu=visit-ougϽϽϽϽϽϽϽϽϽϾϽNxmbHwi@stlkplyraull,mskhhturn߽ face="Calibri">hisorse'@eadhmewardithighteneeart. minitoodybbedsidJAfe,wclushA,߾߾߾߾߾߾߾߾߾߿߾ޭfelt(rishuls0slyarmedhadcarcely~reco@iroanger lefom8ritheaso񻯻绯ϼϻ_h relapseǹǹǹǹǹǿwǹǺǹǾ??My8yvdouh*firstxpostulation; didAnoyor AgneoIEIȻ.O77O絏Ilohll,hoIquiteble,7replyŵɶknowtllak(ImyC:лْgetchilhn'hobe8eIweaXrhmesnobody swǻ="0">shallavenyore."

ofwyollars--ilastsomeime.oxlwaysovideshenזזזחזneedsreatestndP,fterdminisXinglittl0e______Of膨wife,Pdshimsel+busin (cH//th0innY5ahungrylock.''''''OOOOooO'Ǯ'There no hnhouse,t(excladurvey0OOOOOOwwwwwvmeanPtjdisposalǺǺǺǻǺǹzIu8tsipoenoughmake:sai󣉾(intly'''''''''GG'YouW8beuietrepliМRusb. Wdoeweopotatoes.utXmkfɣٺyBsyour׻׺bedsidihow(`wixim,xcouxV.ǺǺǺǺǺǺǺǺǺǻǴAurxlaP!fromrPᾘchorпsproneless`sr.antonandecxdeniu`by`lpooooooooooonmuchJӿstrarmKgoodll,feZtength׻Ǽǻaccomshinonworliн ner; whil putǽǽǽǽǽǽǽǽǽǾǽdowniroise,ndheotatoesereakingnoven,r. StantonavQenjoinedlencisoisyroop,atow`p ilhX,ywife'setorepaaermonWWWWWWWWWWwwWWϑϐWeou(thXthoseinisterhoeeleyannotompawiut??????????__?>tudyEiriestpleas`8mHwhǝǝǝǝǝǝǝǝǝǞǝƣafloor guard!thickrpetlefullyelievedOOOOOOOOOOooONcurtainstapfxd*arrangneatXconisߪߪߪߪߪߪߪߪߪ߫ߪpurqxadjuस8sf8f09s8d[vitrouXoooooooooooncofigum0v ro8{ Wxircumّuchɸiipd.p=drittetextjodomexГxІroduction`GcOOOOOOOOOooOOocrwhAalmoxine(able)situaѡa jny'''''''''''''Zela9(o--qbawoke.ԭttloPto׻׺`iHphYhflaxen-heayxgkeenow߻ߺtala1offixwai`orharxorajesty,b߻ߺshaknew0Abefoɽ,ly3rlorrtkpninxat(Xpreverompdulgà_gggggg׺ggggg`unpleasest1 ne)withr0ߺ.߼߼߼߼߼߼߼߼߼"Papa,0!heeakettle!nly![riedllRyounger8es,ust onearfor,honowsaerlelockaveotagarmeprepdoint[iringssistancesutquion,Bkuilleoney)self--seeooooooooooonwhissiAhusb8perplexedkeptromsϚϙappropriatuties1c dredespiell-meaefts,//////////OO/.suffeqQosettPtonPe㢐give.ߧߦWiإanysoriri˦ȔRb`bep feelGGGGGGGGGggGGableoagainostryver-ruxljvigdzdzdzdzdzdzdzdzdzǴdzdzchtityBdeclinisinks oY@gr?OOOOOOOOOOooONY(tYptrutorf wifxOo,??ߟ@y(sh8§va3XXerninPhaslyGGGGGGGGGggGacrificlsid噸rty nan@s.ԻxROOOOOOOOOooONHarHteɹbMrJudshallow)hBi`emmad"atchworHmoC@ans;pSveyafuPPgreȦnamelessԠep077777777WW77l-endugؘAsveidow8nutg">sѺXssa0field"nonHthw7l̙sepulchre.gggggggggggggf7777777777WW76hsph:Novemb`nB0enlpn[ firehat blazederrilynearoomftavernL.,hileonusualumberrowdabouthearth,wingorsessionlcounty 8rtatl.??wwwwwwwwwwwv"Mr.ennoxs@pret8smawyer,SegogentleoOOOOOOOOOOooOO>onecorners,halft8ogativHyXchdicatQߣߣߣߣߣߣߣߣߣߤߣwishstcon P//gggggggggggYesir,oikhatwasZreply; doelargesOOOOOOOOOOooOObusinHte--՜ʇandpst--ahur(meߺߺߺߺߺߺߺߺߺ߻ߺtoo[ǺHll뜘sChrianr(ay--gs׺׺׺׺׺׺׺׺׺׻׺myoruildmeetAhou Çortreligicerns,hyrhd.OOOOOOOOOOOOOWell,fd飾sai0withthicare-XvisageW vPxtpdXteriڶnoߺߺߺߺߺߺߺߺ߻ߺeo8o@omeig--S'$mWWWWWWWWWWwwWVﰈR.t not2bodyddo0ɞ羏AlyYint0igeadeomy;JBpep3''Qohsub ial[erHettlemenwalway0n 3"ace="Calibri">withistressingymptomsfovertyndestitutionhenllus comy; youee,r,urin(errg(pretȑdastundayo_______ǝhave0salary@up.Ȁ@hadcknnZfamily,nogWwwwwwvhifwinexpenses.ۣWWWWWWWߩߩߩߩߝ77777Ion't )StantPjudicZPmasuchtstatement m speakenervl΁ ouhHonsultOooooo riendsiv@gt porptiepulpit7߿߿߿߿߿߿߿߿߿߿߿߿ߵ;ThatoȧPxr@decݘeus>repliIer.ϼϼϼϼϼϼϼϼϼϽϣoggggggggggggoN!halksr,hen@ovisiplyP???????Ǻ??__?>blackbers?ɜllouXerhXstknow PtleGGGGGGGGGggGFcgetloXwith.'Ptdtyself.PIiXoun__________^life,8fPIaaair@irrshovelgortwoAthreeearsKwev(thScomplain.Ը@timare߾߽ard`HrhlosJuؔwP@;Mr.aXwwwwwwwwwwwbomeubwXreusϼϼϼϼϼϼϼϼϼϼϽ face="Bookmanldtyle"> SeveralfheuditorseemednclinHtoxpressAirpprobation>thisoctr,oughomeemarkqhatr.0antwasteroooooachernldXNorth,o(ll ybarnin'.gggggOOOOOooOO 4moretellige`circleXexcg smiles,ut?????ϝϝϝϝϞϝdeԆeXglistsv"swwwww''ϡϡϡϡϨ_______]SOmyh,suC.,ImBhavainstudy,ndߨߨߨߨ߯oooooon8ebhndQ,fafQhatimeskeWWWWWWhesnei(edk,@fire;Inow8h'OOOOOooOO̼(m.w,'m wi0ori@'sWWWWWWWWWWwwWVsa+veryritAyYwhenet neydoDzIse̒|it7GGGGGGGGGGgGGGGGGGGGGGgGGBTelderly@ntleIrruptzonsationyay@,//////////OO/bylH0townsStanton'scisopx)ǽǼ?esmpoishhimself9gijreligious׾Ͼ׻G thatasivmore(8QamouhofwoousandollarsearlyosupporÌgospel醡istate; IInkcshowte7777777777WW76so.#בבבבבבבבבגב֖//////////OO/.Teyes}auditowe`nenxge)eirtmostimits,hilǜǜǜǜǜǜǜǜǝǜǢ76afterfashionshrewdem(erally,WWWWWWWWWWwwW'cPu` thaery twistHlXxiwitayingword.ׯ׮/ ComJ,raells yis,+#sealcomHyǹǹǹǹǹǹǹǹǺǹǾ??W,rOH= ddresshimselor.., youᩨaHbu؆ wiperhapsnderas(svie.ouspeaknilawyPLennox.ȶrin8ѼO77bohfromyativelsВɮ诰college''alwayseckonмsmartesttwoHheay(Jeyct.άseeB, AtalЈhnd׻׻׻׻׻׻׻׻׻׼׻educ0omakeshr@thousaea Stonmo,ǾǽچJmiȚmadH";tyevot workmry1t@@gainwwwwwwwwwwwwwwvbf9hrd0ars.oeseot,herefore,nacgive all9iffhnceetweeourundredndxreeouszocausofeligionthistate?f,uringbusineseaspЈYyear,??you,r..,devotXwholimoo@benlent___________^perprisxw2ЙIee1athadirtuy0aawϙϙϙϙϙϙϙϙϚϙφw %moneyowhavad!nstead'''''''''GG''?citharity`rr ubscribr wwwwwwwwwwwvminir'uppor()ouconsiderveryxpelhimYqex)Ypreachz.o H$gospelo,Yhas4uphabprctѵinc9wo''''''''''GG'r߸,z`0tsselfithjlumichl77keep@ulbody`geqІ(ouhpossibillayَ2c'''''''''G''MsHmicaпsicknessdeath0PxiwIoooooooooon1RpC."_7W77Smbp:pagebk/>THELDER'SEAST.''''''''''GG'ARADITIONFAODICEAw׽׽׽׽׽׽׽׽׽׾מ_trtaPtimeћxlier 8sYrhivedc[ooooooooohLaodiceahristielderfomeepute,amednesiphorus.heorld

singular,other?"aid ark-eyedyrrah,sboundhrairnd Qcourteousnlleirengsithan,ti8we8notᆏstepmconformityoyfcustoms.Inime6familypeakYneverrokefrom7777777777WW76Chrichurch,etfouadeeni(mvrduchߞߝwarm2ٗ)0satio bouttha`lP q`bXsWWWWWWWWWWwwWWorfeastoariinities;↸"nesusqerwammediateaXsilenca cor,Ȫx,ectfulauseaft`whicoJa nd,lew8ckȲ channelgain'Ͻϼ ** _W??W?t )now;IsOiphor`EldblazGGGGGGGGGGggG toex`musicall urr r1a//sumptubanquet.wealAfashLaodiceareSChri@ hea`nsatlasXolu s ߼߻Orientalreec)ugi@shed tm@jscenǻǻǻǻǻǻǻǻǼǻIcimeSfeval sxwhadeen߼߻regulat0Hpiri@fom@dJesuAsecordbyuk߽wwwwwwwwwww>whoP̓reekadadeishestablishedersionnsia Minor. "Andou,henZkPeast,allot yriendsydždždždždždždždždžLJdžkinsmen,XrZrichbors,솱@ylsoiee,b77recompenseeI.utGGGlBpoor,cQimedlamn8shalt bsed;''''''''''GG'&fPcanэbP79hBǡǠesurtofrjust.3OOOOOOOOOOooONTh@@yayeRntertainIt)passag`Hin2ars%familyyleo9youngswho,ifferomoooooooooooߵؼK[cher+bosomsimplicity5oldbelief.׼׻ﹿ߹cHowdiculous!耀abd!kzarepm ou`'''''''''GG'&membeϖwhP ػAabovenasApoito/////////OO/oQvening's.Դdark-eymoprPro0`??????????_??">levߩDrild,ndecorЪapplaud,oooooooooonwhich XaidBnoicatioat /////////OO//But,,cbe(txryakitumean77eth .hatHYLordesuteby ?feh tiansy??Opoisith `Dradendxpensefureathen nibors,thus󅠀Yeoneyat턩eevoteXoharity,wadoesXisassagHean?"GGGGGGGGGGggGFY)f!riv0in5s薠somelranyhristiiߗߖLaodicea,aid mowarmly.OOOOOOOOOOooOgǠgANay,|,ay;utɠXnkowtwor reeimesOOOOOOOOOOooOϫ:1vePwanting慺eelievypooe߮߭r@omLcaptiNupportapostlwe??????????__?>couْre.Myon__ⷻyouXtnderstmwaysOOOOOOOOOOooOOorld⦅;hshhe?dha-shupPnithol/////////OO//papyruSt.ukeZPaul'spi.netouchooG7777777777777gGGGGGGGGGGgGG;B@doesholyʵЗ'B tnmeo'$ooooooooooooCertainlyϱȰel;ļmeans(Tbeaptd,q??1shipn eax`emp׾ggggggggbri"> mappeabthbQAC0stame; 8y@adW@nsQ "H賡Paulai'Wenow3idolBh'?h777777777WW76賁haaleg1statu si mȓaummateak__________^rt?s lo resi8ySospproprioooooooooornwshearmfurningxquisiteerfume?ndst worseo„nnlȁpanor?"??????????__?>Uponyd,aidJeanuests,sandered`rough??gacene, ;how eraldccommodat阈ChristiansreϘϗbeh(!xcepaewmallatterPntemplП8eem777777777WW77withsntirely.gGGGGGGGGGGgGGggAh,Hwȧoeapback.ΨhXrmonghemjn,ptraypPAlmTvsٵpoorJsick;//////////OO//methgeiraZ9Ysmuchtalk߼߻`sasЩ@hymat5Hfou___________>himselfuitPppl_g׽gggggggggg_ߺߺߺߺߺߺߺߺߺ߻ߺߤ_;Yesgb9prHn0odaysɋ|bxouؘOOOOOOOOOOooOOeYso ian;louagrownnikeȻ___________^now, i(carcor'shilechange.ttmattϽϼ>cxyTempleKofferIincenHJesu@instea׿׾JupؾjalllH8samcHmasm odds)aYGGGGGGGGGGGgGGG/ Bʑ1anciegegoesЗsayTmidsZgillptvenxtra arkabappspan> xnersasoticedmonghe rX.onenewim,rhence`ame.&놗HeinglHnRmirth,ndeem0toecogn@ present,//thoughIregardllatpassxitheculiarirftipǔǓearnesttthion;’revermoved,pslpenetratYgaze??diffuse8ul8uneaessbout Qsyefixe'סנlquieHcruyidolatrousatues,󡐓v0v??adornms--nitollowX\lyzyouforms ߦ߭oooooooooreathqgrfulvesdaؚ(n)tuwsww''1abl)loaRIyuxu8parklVwYdeioacchHbe9rpoehcah,PdignaIorrOprshHwjmajic߻ߺ.טɺx1t8perri,Hgayomyq׻׺?ddr9,Ay0umselshrinkvoluntarifrom/ϺofpiercHremb:q@@weHto@whichxreplied0spokef;uxavittenderﺧǻǺWisd8pZstrangePcrast]frioPscencϺϺϺϺϺϺϿϺϻϙwakdnwhPidexen(puryȇ9oissipams.~??????????__?>T`oɡ%whoAkBsociet size="3"acHCalibri">youngest,heXirittlehi8Isa.ӀseemedstralytXcted downom8oseyehiЙgloriousAbehold.eteQ,GGGGGGGϠϠϠϡϠΟHglȟmongcrowPpokeearsomehrist@????_?>woQoughhftRlow,Aavystexstartlipo;on@fৢ,ensivybaXGWWWWWW߳߳ߴ߳ߦyrewX]aycen4lostpGGGGgGt.har--whoBhe?ho?quiry !mouthGGGGGGGGGggGGoshaXbpht??`Ahea8Jithtroubliir.Ŭl AK'''''''''GG''rcd;ͭ:nGBeveryo--2uddenlyga@Yg 3rsawmIre.WEfelthQrilliX"spiritbv@atysfGf(itsreattouc$hrunk scyP'''''''g''GG'&omnieeyexupiٔrr=depths__________V9soptriQworldmaximmakfalsokullWWWWWWWWWwwWVappclawayk`;tcᮙHseemgggggggϺggggaPsoeaYinnPtiveH>

andeasonfction, inhe8stinveauseatXssedrough㆏com y, banquetasrokenpdeserted.WWߐߐߐߐߐߐߐߑߐ"Awifiroerxrnt?KaidneIheanembers??ǗǗǗǗǗǗǗǘǑ??,extay. Whyhyllolank?ostvorableomewehou8citXoa 'sPtrxinit(t@t.??wwwwwwwwwwBesi,dopr,ЩPChriansoҚ/iswayseveryoty[but:eye peno??seeim0ore!oWWWWWWWWWwWWZj *WW77WXractiAymeaning5(cep PnformZ׻׻׻׻׻׻׻׻׻׼׻world?Ins - ults,s ypoXmsffic0׻׻׻׻׻׻׻׻׻׼ף?olution.ԩasos8and nd`ftuaٻcircumstanc@>thɌnnocІgefulmselv轷׾׽hich,ikelower[in80aHlta8becomenc%//////////OO/.onbrougho0 ύt!one8_xell-intH襈oferplexed.//e="Calibri">Thateustonformnomehings,sceded;eteholenorf allexpenseoujsohlisitsouch??????????__?>b. ememberJesus,enst eri豙movȼ77bbsorbi,urnasidatteeddf \wrou(OOOOOOOOOOooONfirmirac(0enhaitZenjoygaiarWGGGGGGC3"ace="Calibri">othersho,ecauseomendulgencefastendexerciXfor  mselveinocP3yetysowovenRbinedovilPtYeffech0felodecidedlynchrian,/////.b0yÄȪDworld.owen,ell-dispos>ponnowe2ophrikرhjumedium?___________???????????_??=We{hbunprule:`aJesuǻ׻">att@ion--study--inquiearnest yourf, "WIsora''gb,@oubfeel€acasyavior?--oooooooooooohaympathyumun him--,wiY___________^kipPiin`which1tr0ps.ngho9ex҆@tempta sA!xmoHsi_ggggggggggg>Europecapitacarri=XsA'sictureTitoooooooooooo">yapartmp.efogox`anynumerohreҿwwwwwwwwwwwity,Ȧacc`o`PlьBsayoimself, "Woumy`therishoeeen lPwhichmoing?3nd߆߆߆߆߆߆߆߆߆߇߆thusasavedrom yemptation.nikXannaChristianoooooooooooowho膈alwaysysHdbeautiful alfSavior,indst''holyharm,ӓ`gentrestrainallpatunsuitableǍ(profess Hebutinquireascenhr loym77ShI(epleas0meetKYre? sxǧǧǧǧǧǧǧǧǧǨǠ0(sӅ`into,sBmwwWWWWWWWWWWwwWVuced8xuЅkonxtnerviewT(tectefend!socienjqJMar`>John,rdisciXs,eumilhap@v yISonGGGGGGGGGGggGF8GohXtivitieana.oooooooߺooonǾǾǾǾǾǾǾǾǾǿDŽ_'G''Smbp:pagebreak/>LITTLERED,HEANALOY߾777/PARTɞ/////////OO//Inoutskirt littlownToledo,hiHseen߻߻߻߻߻߻߻߻߻߼߻sm,ne-sto@cott(Qosextern(archi1ureoaytuishitromozeno8residenc[poor,yich} size="3"acHCalibri">itasurrounded.utverhiswelling,residhirfanctity goold-fashionmorn*lory,0crop8dow,nfȔ///////׼tshЦauthheapommɧesϼFЬmillrHvekoival/׼׻ﻇWhetrave9gHernunt)youeHsuXaws,`ϾϽ9no!sctiynowHat:shall @it?o2Ǿǽeem)y-s(8or댁-kuturXZy߽߽߽߽߽߽߽߽߽߾߽muspurt?reŒhtIoestϞ0s''a@ltaddearyiblpbtiksanciearkо//////////OO//8covenh8wirٽ{ Xrx??clouwithememberppraytunselsfa`r*moY??????????__?? aroffewnglhome?0">''"Bookmanldtylep/i8up> t1sew--`hiron;;appHing"0">exquisiteeemimself,hosehirtsameithuchultlesslaits,

Inheveningsfterbabyasleep,redat hisorith imm(urchem0mihief.ɾaszupsedlA___________baskepؽovBelYit@ȤxQwnsi0deadCwithXc@iYlrdryHiZwa)bw___________mntaPthoulessxsp!@reachǓŔ(gggggggggggffoustuffingrsolempussyAinyjar,___________׋ipPupk ifreshly-iron$WWWWWWWWWWwwBookmanldtyle">jabberedeanwhile,nostnexamplBabylonishialect,erwn boyrewrgq:YĆlth[feerطproporqiteedQoron.Ӱxtimaho@week 77fousce J8crawlrombsha(gi8aguo77burnfevIwherpsorwhich''rཹmoastoodeemsԽsumɽclwornut!Hso!leng`ciPpashat,YstȆh߽߽߽߽߽߽߽߽߽߾߽laboramotl`qcutt,ippR8tr@tgeniouspomwHfoi׿׾selI AdarlPhrly bbyP////////OO//nYney:tsai9 squ@do(P'Poy--oXenougAaxh)l®{ysqideagggggggߺgggoccurr#piritedittleellowimself. pleaswithrboy'smjpromp(otions,uienlistϤϤϤϤϤϤϤϤϤϥϚxonhisrhfouliRser. "IHould~onlyasuap@,Othiliket.cƢ8y١ r7777777777WW76matz8pox,arycriedCѨ eloquencejǸǸǸǸǸǸǸǸǸǹǮbra@ihneoykwr8sbe esf_____________^supЬwinsufficiehXco.ﺯϻϺEPimep4aXneat,ulittaaiwna????????????? 跨owbyapraysaw igcheek@parkaleepQ8innocجؿtrustfullyheartHJins*thsxirtyxroncanalo9rɤatmesw@0, 8ɤbacco#dk(jsPZaIlf(sP:hrohimutm 0e?h,ppyo(r!ZIyourstendaskself,fobligзdoyَC!norem!ive">

Godhanks,@erefore,ouPhoXhrhitosheartills<13膗enoughqbreasP0darkavefife.ԅpooru*row1mn,/////OO/.sink Hswim,sappens.ot @e--ntfreedom@om~car/ommodioux(endineurnituYa@0t?????ϙϙϙϙϚφWompetenceives s soch)thiJatpיייינggggggfableshelter,uidhrestraeducatHȁHplesssaoooooren.gggggMaryielde(tbo merhoZsubduws`ecitySor0fully8ethth@p8nIedeplittpackago//o`ᩉunibhimew minup0ingounselsZinuctioIFr(wؿk@y.esagrepoiabouhiЯopr'xietylued--8ӽ??????????__?>bXoگPkA+;nevswto:ropIspiritnatUaskX--2(?wwwwwwwwwwwThenliorse؆h@:_ day getGGGGGGGGGGggGi#he⬨ڿngsmoney;1(/////////////.R֬JedG߿߿߿߿߿߿߿߿߿߿߿߿߽Physlorardship notx1aneewdHІAchihinuhtry. 袈scarcpnytuaa/span> Americaherehiwounoteceive,smatterfoursgoodfxndhelX;(rstenverworked.nhese0spectgߌߌߌߌߌߌߌߌߍߌgeneralpiritiatuXperceptiblmongmployers,oat__________^redeeXnonarrowiadven s1brwistngߙߙߙߙߙߙߙߙߚߙhnewHtuation.OǞǞǞǞǞǞǞǞǟǞƜ??Toe󕩜0soonou w9fuoidiho 0ura8rPday PBĆ@pranccaxbout?? firfpminutes.@Abackchedlitthxsrtiff\e ІJnaH,eeRtime;uϽ'''''''''GG''ndalliHe Zhealth tr8tghccas8yicKumrarreiousbyYr񌱻whomhadxhye0iheyai"ahap7777777777WW7whaxlwaysdown yf,hmich(youould;ٽgggggggggggfeasila(voritjm.Ԩa0blc,iqumselfarticular@makicocakSsMehdiaymnxfXsurpassexcelle8rinto7ùbeYequ(eYkitȢ@pXetǺ">l,otHp@1var1aH0crapлfragts >also der2tourʧ9moralducatuminߺߺߺߺߺߺntize="3"acHCalibri">exhortationsndxposiofcripture,hichomewhatuzzledoor tasotikmor'sh; `nyhad`s`///////ױsouhthZnevcouPyrecise0maAmeanЬ/DZDZDZDZDZǸOOOOoOOǼAs 2bo,dojusticcein`tXo򼷼׽׼conQrabxpurp@.ȼidsw` yet+souch׾׽PdaihseemostaturalAieorldPnϿϿϿϿϿϿϿϿϿϿϿϿϞ6oneza8иhtffeXtempt迧pxiirotaheyaicha(񺑹xfulkep(8littЌq(nc(ledgY=.any῏y r rodWrCPmile_____________^unvforespstrengsolukb1Atggggggggggggg`homiscsǽǽǽǽǽǽǽǽǽǾǽǽǽǽǽǽǽǽǽǽǽǾǽTXX;it9Yown}be@)bab3"> sister,oddlingboutnrown;nd(epeatedhprayers<131su@hymnsisoxrauhim,thusJgooestill//grewithim.nt,oery@uishadventures,redchievjourneyincinnatiRback#proudfBlals,77ZAwagespockeHfouimselfgaat familiardoor.77ooooooonPؚ!aQrprisewaiT8P shadowXxwasnceoooo@rlitٯԮdweljgone;rIlat`??????__?>footHpti0esbusy Xg8ll,l8OOOOϼϼϼϼϼϽϼiȓ8dhbefore,laspsٽQbosoc0 onlyom(t. au8sugarlumٽz׼׼׼׼׼׼׼׼׽׼׾hestyPoraXsyet;as!xm)yؼ߼߼߼߼߼߼߼߼߼߽߼redmow!??????????__??HddoeeXzwhenheȯsuchjKwohloHRaby,C impli[rosS`8;WWWWWWWWWWwwWmuwork0rdchixYa獸dditioKcarespndOOOOOOOOOOooOOvpityAnborsP"IXhbe 8yth׾׽too.Kutrhap8verοRfбHaǽǽǽǽǽǽǽǽǽǾǽlifelsehobarrdesolate.Խoften, ˽pan> humblestndoHunculturedaA,definlongingpinYfor.󆟆theeautiful.txpressestselfometimn lovefirdsbof77777777WW76flowersQneehIrosebushrJcanaryBawell*rom77ϓϓϓϓϓϓϓϔϓwhichsanishpevetrxYluxury.utittlhild,ittsǓǚ_________^sweet,piritualyeous-like8praؚ,77ϠϠϠϠϠϠϠϡϠearIwayButhe tas,pataryerselfsearingway.Ӂhadorne ??_ggggf'Smbp:pagebreak/>PARTIG___________??M`h0fterwardaecemberayouXturp9Xp//trincinnati.Ӏ`thyhadriveng'canaloat;nowtoirin@EwourȒ7ioiemployme`tillpr.Çs@ g77mustpplbeverydyjbusybo irwnfairs, height="13">

andushiftorimself; soithalfsagesnjpocket,<promis0qtrest,Qstartedoeektune.///njnjnjnjnjnjǍnjƊ??Itsold,heerless,ray-eypday,3aiatinpd~fingerhtoe eempenetratene'slosiknowGGGߝߝߝߝߝߝߞߝw8r--suc 0iteedsPirehhappihe`םםפoooooooongetlong allڤB,nluckilXFrhadher.hristmasWWWp`achȓkshops"putx9holiad;ﱇconfectirs'ndoweglitHrklypyramiof㳘y??froscakeunfadafruitfloP:veryofǿǾsugaT`tooخSantalaulargf quЮ8kl>visagback@dwڒdesirablenickknsgo!npimneinx/l@nC`innatiHho级ǻǺwaarou+stly-PeacclamP.nAǺǺǺǺǺǺǺǺǺǻǙi풒beqpeoplhr8gazcha ׻׺w0xiousapHmamxɴCraveliscusstinǺǺǺǺǺǺǺǺǺǻǺtrumpet8dollpXeelbarrstoygQ777777777WW76FneXadard`aid, "HowhQits(о׿׾inhappinespughoq'syes!ut8el@ome߾߾߾߾߾߾߾߾߾߿"3"ace="Bookmanldtyle">liketseovedhrough@eayndustlingtreets,herevery h la8cgpsmerrPhildr passedng______Ϻ_____Xtar#swwo8lacknnetYsledWWWWWWWϺWWwwWVlikPis".utlLnobox im,cϺtii'height="13"> Justhenatterfittleeetasardehindimnflagstones,(aoft,abyoiceaid, "Howo 'oo8?redurn8in//////OO/.amazemen xrxtooAplump,osycrea@eYabouwoooooϔϓyx@withimplcheek8ulipwyq.hedresszblueeli,rimm2swan'sǠǠǠǠǠǡǠdownSco)xiysoxquisitely,BeyeclAWWWWWWwwWVhatSfeltlmo ifp٩angel.Ԏ@ltg׭׭׭׭׭׮׭toddupo|oldbefoHaewXxllll//////OO/ߠndi:silk۶,ed hte`spoymakٙ'''ggggggggacquaintanshouh`xpsis8쀨filkǺǻǺtaO(𲠓ȀY hopieway,??????????__?hi膳oAwspsaido''''''''GG''coaxPly, "Nooy.{~GGGGGGGGGGggGFJuhnsoorpenedadrich$,art`outWWWWWWWWWwwWWexclaimUWhMaryouroguhowameچXe?yntoppishor఺зnarrowonz7omew@wwwwwwwwwwwharpoWh@oy0?ϞogggggggggggI'mbody's,dgett#,a`chsinyle">throat; "myother'sead;nlyatown eoesteorhile.# ith?;sh door׻ϻϻϻϻϻϻϻϻϼϻϻϻϻϻϻϻϻϿϻϼϻIPasotney:want0jus:nûpidpaWWWWWWWWWWwwWVa0avy1rt. skyPokUstreet??dri1wfrozɩxisheeks h8wal''''''''''GG'&lissslypwnz*ismalȿWWWWWWWWWwwWWIgoackё anboat ok,\ou@~himselfHhIleepshx-nifcouldn't߼߻aO qun steps=Hde(mination.ʬǻǻǻǻǻǻǻǻǻǼǻƱpassingPȿly-ұcoffee Hse,mPvoiceailm,Ͻϼ_stopped;eouldeladvenoeeoghret before,ndfourshasswhqwooys,HcanalaWWWWWWWWWWwwWWacquaintance@hailediminvit`tcoff(house.he׌׌׌׌׌׌׌׌׌׍׌lazingirsaravehatismhn;ɐsWWWWWWWWWWwwWV=efullgley8g rallyFr8phisǙǙǙǙǙǙǙǙǙǚǙdoleppear=sistit#s tak`o hGGGGGGGGGGggGFwarmithm.77ooooooooooonZhesitaYaPnt;u*txتxdesperPǯǯǯǯǯǯǯǯǯǰǯsteam,Xll-sweetenb)aglo@emp. "Whorжp?ǷǶWhwhy5I ̍cownirspirituཇli(r꼀0d Ȏdkin`fewielt὇onder!changHCnoortimid,@l0XhhB,WWWWWWWWWWwwWV-sick,rzIhow,Qhopecouggggggggggg[towag,ala 0y@uҾɔ suchxghermsmoney9hisocket󌹀future`tionsٽooooooooooonprocэRtwys(nk8significantly xeaor.heyroposfHptwhilwalk@seps.Athr0ҭitakennp`m)extrarriFrw1reunuء)ulP`quit9side777777777WW7imself.ɠyng:uJiԧrٓycream=hnt> thoupithinimself everadardnd uso @ytywwwwwwwwwww!gssnhat y Pn.tast@eyell uiteress''ofoys,hoererowd8ouaonfectionawindow,y(ssual(suchasePbegelbogrscufflYteforls,'''''''''GG' hiFredsspicuousaigZum`hiϡϠsuperi`!odgeYfrєoueroBuisospx;/////////OO/.ٌ08opmoPadse`mas(gh)hop.G׮׭TQaealprabble,yxhsSߴOOOOOOOOOooONhavbeen@businnoskilfuescapoߺߺߺߺߺߺߺߺ߻߭fursKcaAommЇ+icer*#ql׺׺׺׺׺׺׺׺׻׺ׄemony,rri@Qlockupwat@xsm߻ߺ*sJnexnak0bex8mayoaftǺﺇ>examinacxjailggggggggggg׵!sob.ȽPamBD 1HareamCOOOOOOOOOOooOPwhelm@ag8!sh-reachhadro9___________^ mijseHmoXr--±drinkp!ˎheartile7___________9@Yo)horroratrKalwayssociaX___________ worAX)--pl''___________^te)нilmostmpossibl,climaxfziv> andisgr(.heextixpooroytretchedimselfnXsard,lonelyed, laidnder{easittlele,㊨aining??fewlohsmyr'sib9pnobȍtoleep._____CoPyawnfollowamorhFrҒQowly eaviawokwith◘8chillfehirecallWWWWWeventsIQlaswos즘up᥃iron-xtHdowyroherlesss;ifnrrosoooo''before`mageɫohome--Ineaquietom,whit︇cur1Ssnowy r,ꚪowcot_____esidɱױmiblueyeqsym0>sixnthhgo.echaniyunti,ck dkerefychxs WworldPposs ionrelicқ T`m,ean-prinBibߑpdio xyearfirparting;!asoftrhhairooaxпЪĘPnhoetȇpwabyraaa lgoldIlaimemorot%pet.r(ʿahedAov0hsfQtreasurEsobi{rtu!`k׿"Bookmanldtyle"> ludicrousmitationsfveryormqworship.heneasuaitn yr0i.׫׫׫׫׫׫׫׫׫׬WV//////////OOAtƢsed8cliahrinkrom0s associate.insttivXee bwinvisiblegel,to??sper, "Be e!k¯l,hu`bitx//////////OO/.ts,sllow-so@0fort.Էi??ྐi{aso1nySreQasѓk777777777WW77suc9a!ma)ze!,a's,aturallyWWWWWWWWWWwwWVbuoyanbePepgbr@Dickʽ drout߾߽0hisimp@toryhowcaB{f()hǽǽǽǽǽǽǽǽǾǽǦBa0Xouqoatron@؈JGGGGGGGGGGGGG.eaquitHilPލҠceedb//getgҥ1ito.׹׹׹׹׹׹׿?׹׺׹־//////(<''Bookmanldtyle">Howtrange!--theeryceneshatn@eorning l@ed onlyith madellther:senerable."urewcquaintancefairo Xsoon yotuXHn first-racards;hǰǰǰǰǰǶGǰǷggggceacholay;Z!gaempt!wsprQnOOOOOOOϷOObed:JfȀ\bsorЮ׽׽׽׽׽׽׽׽׽׾׽wqhimbapwPrHiPtlearnqorOOOOOOOOOOOOO_m8kefeltx)self2limmerQښϺ׺׺׺׺׺׺׺׺׻׺which,yindl ycannxquenyn(floods1wn!?????????????>iУcocious{olypofOOOOOOOOOOOOO/nxpHgamer dayswon, hse8'sWWWWWWWWWWWWWVlittle ɝHBquiheralreithmoney.WWWWWWWWWWWWWVhaddprisfauxvarmprovementPabunda_____________^h:nabxbuy6brou`́IoitiO_____________>ghecapao rgedheirstightromis pocket,oraidAnevere@toailithoutrovision;!nhotater,nduga\lemonspeppermi8dropsPrell׌׌׌׌׌׌׌׌׌׍׌֌thco(geyFrearn@onc؇`again\___________atalecretfushccie8mHrTbit`ePir_ߙߙߙߙߙߙߙߙߚߙdeliriousappinesasickj,ps "gettqbpjolly'una8ou@makometjyet.s//////////OO/.Aity睨PP8hawayyت8suddenveevil?--ِ??trprayhop|sapochild'Xt?׸׷No,P;any:BtempsleptidP??????????_??">Rivټast;kneelȍWdel//////////OO/.morguardihiop*eȌtXs|rse,wwwwwwwwwwwvwonde٪drP(angeh`#him.ԔbGGGGGGGGGGggGGmesawjiswalkwhitf1ag777777777WW77l̷gom;uetwemѾat0lf//fixchhnc wark[i>cse!noPr0awokeumiseir.gggggggߺgggf߿߾A¾aresol,;nesⲑawwwwwwwwwwwvto-ro8"drinkOspeakhwickxwor{ce="Calibri">heounotlayards,raughtick'sadtories.h,ow y generationsfhosehooveim,ePariendourooroyn0s imphPadjsacr8recocfar,Ch/??9naren.ȡindsqplc??ey# timeaien$sanߺߺߺߺߺߺߺߺߺ߻ߺ޿Hom@.߿߿߿߿߿߿߿߿߿߿߿߿߿޽??????????__?>rPhapppeaaprayeosit"cein//////////OO/.whichƢwason(ed.ickiH iȐsolWWWheight="13"> complncy,ollingisobaccorom`deCin mouth,nd<Ά>meditat)o9msubjectoromeutureItrionicxercisefRalent.7777ϒϑ''ButzvoiceqselpoFredIdaylaungeon.llthemo8remor8eirheartursthbitter//onfess(sh wiP0ypopd4storo pwwwwwwwvfriendly.teedsotbou0 ,now9aswwwwdawnђhɒreleaP09ׯ____׹׹׹׹׹׺׹֏8ِ)ful car reader@hroughltepsyhich߹߹߹߹߹߹߿7߹ߺ߹ީ* transferiKiesid!~iaOafxwar0,gupi8`Raoodﻰcoupl8hoȇQnϻϻϻϻϻϻϿ_ϻϼφyivi(farmʀHHomincinnati.ereevilfluences'''y0plantwaxsJЍbbeggrow瓗gain8h0becamssoki`fami@Qhadophim߻߻߻߻߻߻߻߻߻߼߻THEANALOAT77777777WW77WWWWWWWWWWwWWUOȷwayڲvellbtmolocomotive Aonthsaidele,canaloat, !moabsoluteroc="13"> inglorious.heresomethicturesque,ay,lmosubliminhe<憗>xdlyarchfourell-built,H-bredteamboat.o,akezwwww''standnverhangbluff,ehioindstsreafil8,rsdyissppi rpath)oughnbrokenoooofots0itlloh8toodoe;gallaalkQwatewi苭powerful;,ifabledggggmon r9v8ؒfir ma9h ou؈)deeppiratiڬBmy,v1w,//ӭy.әpcurlAupgaipKskhrosyorn--grȋql Pqgi8xppancRoooooooߺooooftgentliituapqszQQinkisߺhfairy ;ksb orvehoٴXmo;wwwwwwwwwwZhowxcell(serv),yorgig0icaks级ǻǺReniiolcet fe(liptsonly ầǻǺ?nwr dagJwiaP`!@Ѻ纟confessjalaimsoPлbeautiggggggg׺ggg_T.ƑouwnarZwdamoYmaceI_______Ǻ___obX8 8lla08ducurselfre8Pw׺????????__??@sider aiousborhoo܆ayi8ҺOOOOOOOOOooONwhizzes3suchd-deminaromescapealve,etart asfomefhpiritshrefters.utnanaloaty isopo,ysybdanger;nenotlowp,erowned,7777777777WW76unlessySspeci(effort:seeslearlyllǔǓcase--aorsaopAndmudd8tripwahthh.77ooooooooooonDidouvtryt,eader?f8taknmagina0bwithHjust xperiment. "T'sY!Pclaim(asseϫomnib` aHrollingrombPittsburgansionouseo??????????_??W?dozen1voice񟈦 h hs77gowinW荚Z,n`Shdge;n't׿׿׿׿׿׿׿׿׿׿׿׿׿thoPlsm{llh%(nencedravellde!halfuseniNTeed,ú777777777WW76saysomehS ،ssIk'llЯhhu׺YmmoloHus.Wmpossible MY؎ initiated;so`q,dobProo,٧Haneraleakloɷ&Tow Babel,??????????__?WmiYfeciHtormjrunkboxavscarpxbag//////////OO/.everyescribaBapsterll߽߼ plL "That'syrunk!arksutig,ound . ρbandbox܆77screamsheart-stricken0lady,nerror hermmaculateӇaycapsWhelittleed @?adwoarpetpg0a--MTGWWWWWWWWWwwWVqahle--Halloo! youoingithortteau?ϛϚHusy!Mdoe@f@ergeskЌhair??--O,FbabyxcGoelow--gT,mercР''ake,d;'llRtoTggage.Atst,femininefׯ׮tion,eivchisihnstanc@yain77nobyublicpeakHcebquietly `Xchesϼϻ*musiXؒ ismayicha(new ivepһ//onf8erreshemsel.hoseosognor?po assuppIbo@cenougo0j}irsind,ۯ0 pectabolonyold''''''''''GG'&ladie`Bm8i`†ьp(Xsldyeরshed.M1 pussaysXafrveyKroom,?bouenX@gsix ,webw8leep0-n?77SOe!hxaؿhildrenaou0 0a8airߓ0MPoh!nitiat0traveller;}aٻ߻߻߻߻߻߻߻߻߻߼߻let'see:y;woXrner,woHzsize="3"acHCalibri">andutter,hree; then)re'satqowithwo.eally, "re'sႰfearnunatur'.sWWWWWWWWWWwwWVBut,eanwhile,cXdrenrowleepnd HerststingittleduetptrioriseromnearPrxoabin.??'wwwwwwwwwwwwwqHush,ohnny!egoodoy,:ppaQnurs mammaorOOOOOOOOOOooOOstl@, te-head!henom nosHyuchtarge斩lapgױױױױױױױױױײױױIon't72ei}pondsngexpPitness; 6ag(od;so-!Įٞ˝pkesp~mouasig9aeacuproa⤊courag`hФasksmexecuteariouslourishes;heisconsola(morsgh,nd삐s thathirtyadiesannotllleepneowesthelf,resome effortadeoxerciseithYdoctrine;everless,lirP8borsYfearndrembling;zwhestoutytalksfakᒅqmourgentlyreohangelsb`arm`=e.ointlocatipbeftil77adjusted,satruggle.řyodyaPefwwwwwwwwwwwvbonnet, x awloialoak2geШrpHbagndבּ!bitcsuchealXhP0hn"Ma'am,ou'r߮߭ myot!KayHWieamove,X?,ǴǴǴǴǴǴǴǴǴǵǡGhoqgasp­Ț9bedN]echo-IndeIǻǻǻǻǻǻǻǻǻǼǻshou0xg, I'eeYprospectIit.ۻǼǻcChambermaidcs,XGmoheap1K''agcdren H8cabin)poor??????????__?>cgwedgf,Pmi8tuZt er.7777777777WW7e's$Od'XyifcʩaO'OO8baskeNo'yarasol/NǽǽǽǽǽǽǽǽǽǾǕJgmma,ushe߽Hɝrawlrire/777777777WW77liti*Press At0howe*ariousϽϽϽϽϽϽϽϽϽϾϽdi@arH^b8hsinkPleepȆxnPaϽ''-(urAbep,hehambermaid,eeksutomornerorepose. Tiredndrowsy,oureus)nkingntooze,henang!oesheboatgain؉Hd(oflock;opscrappmhrun"sh,y??uplyZhead[lltopelfitesэ0ge morjuvenileairyart qcomy''''''''''GG''~"What'at!poxifromuth8K;RPthwithGGGGGGGGGGggGF @rocexawak0ispectivelations. cMor!uHannah!''do Qp;R驁(awfuloise?O,nsPrayw''still,groɫleepyє|below''___________APexclaimBvivaciousreatu,verJale@wwwwwwwwwwwvinpm I],ay<׻׻׻׻׻׻׻׻׻׼ׯϹϹϯDon'tounowC,sy?o xowngoߺߺߺߺߺߺ߿Gߺ߻߯o;.翯Bsay,rhiYanyang(it"(ͺoȻ(queristVDBקҡdeafﺠladpokingPrpadcY'2 ter?ԍhnothurst,;No,P,~no״provokeddhairopposiartwhoiZatGnuch!goiEqyPvde theld ladyelownd young iesbovenderstexactlyRphilosophyofock.fterpw@econvPationgainubsides;alls??still;arntramplihhors,ripޓrope awa,sleepisteٍ.وdoze,??dream+suddenarepartedycry, "Chambermaid!hkGננננננננסנupr thathntsoxetse.Spumpsㆧup!ǧwoil8n[forthwithQmommittefinquirwaymeans.Where's0onnet?sy ,alߴߵߴaitumb*amovariourticl0*nameIhouPwwwwwwwwwwwvIithidoorMan'tf)iǏ9pyawnzPrubb(yeO esqis,;͵cloak,*shawl[glho receiveach epariscussion.txsж8seems egomf,,o!etercapingNowjcXpbe''solilozUputCbAeableg;ay`i''gopnxsomybths 0thsuggestЛS7G___________lgouxdeealove,HkټB??ditIsleepermHOE@exclaims,??pullPblack p@oneillow,deethoseᵸmyshoes,"aysheexedleeper. Maybet'shreresum@arting <//uponomethȅ knnoHrerthNo,amyag͇8doccuht.ԍchamxmaid)nroceeournvall"childr8onfloorPoefs ndm.nCoursefhichߓߓߓߓߚsyreostgreeablyak0uphdnlivened;zw eygggggoooooonbodyQbroad,unritisRap;Peterooatbottom9nalieoodaexclaim8Wel sǯǮisn'tucky;Z荈8safnskex|time!DA77777?????__?>depsm--w@qI?--crationspTwhol)my,ϴϴϴϴϻ׻׻׻׻׼׻֒ieyough#be.׹׹׹׹׹׹׿׹׺׹־//////////OO/.SafjollowuK whoeclarehat(eyeeluiteidewake,--don'iink shallooleepgainx-n!@andiscoursever(ygn77creation,ntilouhar`yshweenoughelatedpm@givQa ld.OOOOOAtast,ow,oicpftcdropsff;finaostWWWWWwwWVrefresslumber;8eemsY bout@qux ofߣWWWWh,hehehamaidullsbbeRve. "WiQpleaDZǰ>getp,a'am?װ(axm8Zbeds.[ٍtdR8Sure?????__?>,:*snQuchor{onoardanalats7''''߾߽~Lqsotumerzifer8xitieYornYtoilx>aɺyHdyȾz(ّcib(ond л׼׻wo9whodndaroom:As@q waslbow )u{te0e繨smadѱsw thirtyis,eϿϿϿϿϿϿϿϿϿϿϿϿϔ@vvas;9--inath!--towelymy! timyٛ'o8have,a,clHestineslxPo:gentlemen'sbin,sot"edPr, 𧰹Ho0P@waymogeaXnreci{ooooooooooooooxqftPrunaApropthath`d.I'inwwwwwwwwwwwwwnothin'fohnny'shoe!" ;Hereanheateritcher--isis it?7hMydeombhreonVexclaim1nymphithishevelledurls.//assy!o tyonnetnlady,levatingߎߍarticl8rudxtos yglePi2piecaincXOWWWWWWWWWwwWWkIXrdleepouchogeٍlife,cppoorttle''''''''''GG'&Frenwhomeir荘driventalkaEGOOOOOOOOOooOOǦǥButur!rtenpap@warnssotrolo؁icaogue8''tressbeyondeasonabbounds,d[fowilllosYthdvisz)frie*ȥ9htryZytraI(//plure,akxotock p(0hл0towel">m,!Ank0Xyfi0aba0neyQϾϾϾϾϾϾϾϾϾϿϾϼwwwww7mbp:pagebk/>FEELINGooooooooooooϿOOOOOOOOOOOOOMT! on8studyhunatjwhich veys `dlysepfصHumentsccomplish:erllans. nerregardsmx)e0icPbedmirxlaugh``caricbeaudeal77omieArdbex`hav¬t>that〠sufferndnjoy, bemprovedryruined;s0ose attaint;ho,(ileheyweeplongithelfishurre0of Nowround.hofhesesIostnteresting?st(a(all,slender,azel-eyedoy,ithlanceikepfalconhoelbows 9'''''~onPb:ssut greXbuttonwoodree,nd חחחחטחcxula)ؒshix*squirrelapenchoola?roooooooo">Ecurly-headlittleogu8YPkɔJreppsedoooooǤǤǤǤǥǤlauxer see)ahick8ro8ovin8dinnPbaske______^archblack las deep,i@ievousmp@oooooDZDZDZDZDzǙheeklylyэKfish`toskirt8ras'wGGGGGggGGcoat,etzsbscthAimedxie)_____׿׾turn𹠠)way?o;artelligenཐ`@eautifuWWWWWWWǺWWwwWW>x1noi.OOOOOOOOOOOOON77Perhap`n,slygirlxgold豱DaGGGGGGGGGGggGFmXh0k f-blow)sebud.e*mbrasimbh8feGGGGGGGGGggGGfXr,ratchworkropromlablueyslЈwo violets:dpgsnkergggggggggggfsi our:ure 3.hǺǺǺǺǺǺǺǺǺǻǺBȺ`;corner.ooueeboyssuchPg@myǻǺcouxnance--soacayeonaed?ȺsoXhh veryeldomoesnyhing.esurlydloomynhkyd wwwwwwwactionsnehowedmoreptitudeoayH PdoIaretty''ZstraAhiteai፸ycPegula~blamzdunishAyay,2the[@,''pworszgrowNonefRboy*irlsschoolilllayPth'''''him;,o,Kbeor it.Ўaster/////OO/s(ؚYt "HnotnowtoH,[ԁheCmaktroubl@y φ simiudiciousggggg״״״״׵״inmaaikendencxoomoimPvemenTX______s!whIp𧡴;stxhestRne.㻯ϼϻwwwwwwwwwwvˉgxcauQpleas;IPadϿϿϿϿϿϿϿϿϿϿϿϿϬ?abits/mwroe,(resflues,7lwahlike;q. ǍnjecomPXwyeanstemperaiich𥨹QnoHs/virtue.ɣseelX,cuxes givȺ῿counax `x9scharaco((.noȶPrndl-sufferfribgtoo.et relatki𻐽oo;a()e hpaRat________^>languageforldlyharity,tayeaidhim, "HeuPhave smiAp饸merbexe.Which))mostesirabtemy?ɐHPhar2Rpowhofaqe(sa* BAXyWWWWWWWWWWwwWVinvolڽgre(risks2y oht8happinx+??our!rsecuaortiosuys,ithcertty;7777777777WW76thٌAe2Ɍ dee,hceGGGGGGGGGGggGFwiXpupearlsdiamondbuinkcaH77ver!''''''''''GG'_fontize="3"acHBookmanldtyle">Butowomesaturday,ndchoolsustut.Áanynefy worlHsark--nobodyvhim--iPptASI׵׵׵׵׵׵׻׵׶776ownult,makImatst98se.׹׹׹׹׹׹׿׹׺׹ֹHnڥOHarriveaɝiciotabl,7//couhPoonxunicatedг(stnisconsol(g g@fencxtdPelhains)playababy usetrwoph0*notXkor@ildre I ȱ ff`ntyeo@龿߿߾dobaithbm(߾߾߾߾߾߾߾߾߿߾>bxoflosYnxsweeپQfork7ewoнjustpenZnbush׽//////////OO/.hg)pussy,oo,acingndcamperx,ithittlellenfter her,mothe@ysZflowers;€birdreng؁treeoft8nbrush;lossomsf+weeteagainst//isheek3yethoughQatuxlІxnim뇐l莀is~wretpd.??wwwwwwwwwwwvL8usowange#cene.hyh atrowdedssembly@ϣϢattentive--`sit?os@g?tour龜friendx??????????__?>disconsolathoolboy.utsyeflashYintec@߰߯erv@3emotionJoibreaskeusic,everyWWWWWWWWWWwwWV1nin7ooooooooooooo>AxaPdiduns onderXthaststOoooooooooooooєi.ȷ--rap0happhfeeleoet(which~God膈wren;uIs ImeaаAȿ~spi@houbBwatcRbxofcknessS[bltovǹǹǹǹǹǹǿ7ǹǺǹsPber!ticipat;w ;ev,oncold,ϺϹunrestPway,JquercepYI0pghɺpangel羧ǿǾ??????????__?>FollowimH circlefriendship,ndhyseooved trusted?ׅPcyouaeasilyelloim`at9saooneelseesidesitaharouȆfee膱erst,??appreciate,Ќpuch@byʀs0em?OOOOOOOOOOooONAren`av8unclositsoorsl,Kqknowledg`purityliss,ionQye*pasJnHsoul!rnooooooooooonwipl@P8a!mј)envied--ȆA,r@ߪߪߪߪߪߪߪߪߪ߫߆wnotRǯװׯϲmbp:pagebreak/>
THEEAMSTRESS.׻׻׻׻׻׻׻׻׻׼ר繯Ϲ>"Few,Hvp ,fX;EWTrich2 ah@hard?Itponeedfuoλ1urestebarred׹ǹǹǹǹǹǿ?ǹǺǹǾ??OוirthsrR plenteousnessϾϽheyleep!silkdown//oyhveinkbwily??eJyadieszWWWW______翗総byzwin`t,WWWheight="13"> < ׆ׅYetakirearyorkgain狗withournfulye."NjNjNjǑwwwwwwwwϕϕϕϕϕϖϕϕϐL...????GGGGGGgGGםHoweverinehelevated,nsentim(aloiXofiew,xhaveeen777777WW76Ypoet`thisifriter,nkIn"@nygǰǰǰǰǰDZǰfromKscqaHuo(a8tpinionAhȁXn񱏱??????__?>littlallad which*abosesrвPnO777777WW77߻߻߻߻߻߻߻߻߻߼߻Theyhowccomplishauthoressssnoterely___________^knowledgeereamydewantsubes,um0߼߼߼߼߼߼߼߼߼߽߼p homaoneOfastidiou8ic0oxlqapci . ufferyprtНГIcond@G//hosFmon,quxȸyinurHrdship1dy,GGGGGGGGGGggGFwithض谸0ecity,et錙momswill??нah1cnHX(šHllavi8power--?">gener`Цٌntcself- pectystrugg3(ir??????????__??@inlence, "bepьth3hopʁcY'''''''''''''>endІ*things,atherhanreqordfomplaint,(o acknowledge,ven8emselveІtirwnffortsillotewwwwwwwwwwwvsufficie8ecessities.OOOOOOOOOOooONPausethhil oHyond8room,osmaPwindowǖǖǖǖǖǖǖǖǖǗǖoverlxs8litt`courlow.tsnhabitedyi(nd r//////////OO/.dauer,epe irelyplaborsqneedlatAߩZsl1jprecariouses0`ichrHX:rem0/">wowhlefXotruggwayroZalone2cPsDZǰearthPstoreȚsc`nPticit??ckqfurnituȶhasLhIto0di,ϾϽ icalcula1Kgp,erYingYldǽǽǽǽǽǽǽǽǽǾǽbeade򠢽نP@Earrang@ϿϾutmostatnese;8sc@a/////////OO/.fashionabparsedulxguardromXscrataub,n__________^X0ly-vapsh(bauxheaJooooooooooedsd.ԿfloPooaРnpet;0hTim׺_usyit,ickao maĦl;ooooooooooohڋfellowβЀupindefatigoooooooǺooonzeal䙹ngrkshmischievheryhooAptoggggggg׺ggg߳istaken.ɋȭru1 dnbqgivai8faded ba8,hichaseeneatlylippedndound,Zspreadownverentireun`ageableo(inrofheHpl;or s??havepadithieHadifferolors{yetft ll,ϔϓitsvidtha)eoorarpenotong怸thworld.OOOOOOOOOOooONBu+bestpupon`ery)ng.ԗlittcupboard٘ϤϤϤϤϤϤϤϤϤϥϤcorner,cxainsew@asone !woXtiquatsilgggggggggggfsnicbetdayParrang jealouHpneskteuslwinrqhlbe`YbHl8UWWWWWWWWWWwwWarefulnstarchemo0i@3׾׾׾׾׾׾׾׾׾׿׸Gxact Xcision:uu,xbysnow8@roǿǾƠb`memorialjpm8timeade׾miniat(, cthough пzabooPPt:rǿǾ((wiHWPaidesMrs.0Qs 8rock chai supporJpillowwbusuttіworkH1daxlendsickly-lpooooooooooongirlsXj"pxPsomeine`itcї777777777WW77??Mday@wafe1a `pectab@Xnt''''''''''G''!am#nffectionateamily.utvilortunead`lloweder withteadinesshaeem`likeernecreefomedversterarAnorary ngs aercifulrovidence.irsta7777777777WW76heavyunlossesnus;!nngndxpensivickp@ϓϓϓϓϓϓϓϓϓϔϓΙk,Pchildren.Ԇaeaɔ@elGGGGGGGGGGgGG">largHoulega0furniture,oetipPaumbl@sIϡϠoiv@;bflI:aZ propert8BQvieww?">quittJhor!lCcomm@ lifga0H`ew׮׭on`9scarcelyIexil([umv´ȓGGGGGGGGGGgGG">aiȦ0zwq sud8hsmdow(ypd7ߺߺߺߺߺߺߺߺߺ߻ߺ"> hisIgramade˓trangš,׻׺broken-Prt9discourage stia(iso(jneyer׻׺s؆(XreachyomϠ`dP Yfriend@W׺">twoau8P,nu`dQzjncmpovehedǺǺǺǺǺǺǺǺǺǻǓye`tio8sicknesٳmi.纟Arrt#l辩9de on foQoPidiateHs,ab8xdebo@0hoѾ׾׾׾׾׾׾׾׾׾׿׸Gdvd rvellingpenses0PPǾǾǾǾǾǾǾǾǾǿǾme3ne(sitiXdpuR.ȓ٥delicXXr߿߾xr(carefullyducated,erelacedutoervice,ndrs. Amesouormploymeasurse.heoungerhifell cktXhardarningsf mor aexhausn ca؁h0;??th8recov(part,wxdecl dy)hyitoǔǓbetimaiseas0hichoune8eavtiit_erminzlife??????????__??)on,ow`sdaٜxsohrsto none#שששששששששתשimmedi, zuaborioust.ӣXceha߰ooooooooooobeenblxisy,A(cgdebtsjourneygaishsmroom8(describhб@wwwwwwwwwwwv)laiyavionqself ooolupѱX(!giH`o{firstttackzpaweakness#scinuGGGGGGGGGGgGGBfatigui_asyste8irprostrh GGGGGGGGGGggGFpossibilitHursibusiɭcut8fȭhrem0eb@whatu0b8cco b8ower'sx`XYle.t xtimXskou9lЮupȮ)mh׻׺>ً.wwwwwwwwwwwwwv7777777777WW76Mrs.mesisithg^ڼaHek˰Xo-dP??????????__?>Acarcfiooo;88ТhembP@mh7777777777WTe="Bookmanldtyle">round,nderentillooneue;infeeblenessheb mother,souremoney,hexclaimed;helpouhtoearlleinestressesworld." house,hoseamasknduslinindowurtains xicatedshionable s@ldersskiphgefAairror;qlehe(rxclaimed,Dogggggggl pocketkerchiefs,J!Xelegal$ߩߩߩߩߩߩ߰ggggg77777777ell,,d 'ؙSXshameful'''''''ϻpiecftravaon(Qllxsisav1suihs.߻߻߻߻߻߻߻߻߻߼߻߷7Laamm8eyodyAnow;auraeymouhalfdozenatcoxȄȼýfaisBؑ׽׽׽׽׽׽׽׽׽׾׽ף׻׻׻׻׻׻׻׻׻׼׻ףߣOO;rt,seemsopke Y7ittoddseȅꅡЩɗsmoneyqs׼׻dwh`lived8hJhoupSprStreet.׼witew߼߻furnis2gett믺boy ٸymu,Apohrhnd,+weengggggggggggg';Ma'am,eresrs.mes'sirlomeithQsewing,"aidhe servant.ShowrnWPElmoreEllenntereimidly,nd(bundleforkore,hoforth procee)ainutcrutinyyXrticles; priР''''''''''GG'&selfnexeryulars.ut,Pough2ɦקצadXxecpyeeb8sachqeyes,vP''''''''''GG''coudetectoulthDz___________G׷׶Well,(Irettilyone. hatesourorwharge?۽߾߽߽aeatly-folbillichrYdrawn1}I׾׾׾׾׾׾׾׾׾׿׾musaIinker'scarehX?8e,ǻǺexaѳ!xr empt0u;ܭ ȇggqxso8tк߻ߺ hrdknowsowAlive.SlQtbfancy(lѵߺߺߺߺߺߺߺߺߺ߻ߺglrou roomithirfnoceastonishmhAWWWWWWWWWWwwWVe,䚁Qseems)fersonXn situation׼׼׼׼׼׼׼׼׼׽׼֧!no@xeconomy;ut,mfeel:u?Yday}Assp"threellarB_

thoughtasotuarterhericefn:handkerchiefs,

Xirwnewing,lessperformny H {faandWWWWWWWWWWwwWVbros.)muhsbantlullnoverlHhlargeouse,PacarefxpensiveXrnitur8ד''''''''''G''">suPinincreasera`servTheooooooooooooeHwasutut;I͓Elmelttuty gedone0cheapestyould.e@HQ,٦notable~ladyrsonhdaulto5fastidi ڬ@mak(qu cldmideaitse1b ocompletSectnner.߽߽߽߽߽߽߽߽߽߾߽ޣeqcc0Rselfw89char,oor;77hadlcPr habIclass,B Ythosh___________sk.Ӷdi o,yay0erall؆___________^hPstindepenstrugglAtmpve8оreBdoa瀀@~ngivɇHiscrimin8ozepplics׼߼߼߼߼߼߼߼߼߽߼ߺ׻׺"Don'toupink,@xr3saysPgooiork!KaEllen,``returned. Imuuknowwuch߼߻ǵutHDshirzZᗘ`esyY;tize="3"acHBookmanldtyle">mustutoromebodyhatillotheaper.ɀnoteeow necű(hhcam@`~Zprg0pquh.pxre:Tirts,he hadiscoveredhatnomemporta`respectseyffrfromgggggggggggfdir(ions)etoaveiven,ndupposp1 ;,ߌߌߌߌߌߌߌߌߌߍߌaccordingly t herpleasurenllen.ߓߒ77"Whdn'touakeiseisɑhЁ?ai2arply'ߝߝߝߝߝߝߝߝߞߝߢ7777777777WW7'#e,d,ildly; cmo8rdyatternXy??partcuhemself.Dzײײײײײײײײײ׳ײכǛYouPusteool,irsuchpiecfork.wishwoujytLmackal8C;dї9lad﹯ϺϹproceedwithJG,JhineгZorB[ϺϹtillʾʾanyntima.nuᓸlanguagxfryent0r⤒slowlyalkHhomeward7777O,ear,pwyHdoesche!thouXipooϼW??!thisrning:wafran8Qsiturns߼߻ycomo8wev"Bpuo1do¼;Seer,\,ascxolati`en`ed''room]Mrs.ud`ayZKosomPripf???????>ace="Calibri">collars,ndixhemuiteopray.heays yre ike mveryarnesxnXowhyyt*todistself,tfel@asxrdsǿǾ/unkinʅMworcomyoԾboulWWWWWWWWWWww"Bookmanldtyle">springoeryes,npitefveryffort1suppresshem,she "enoughoayorother'sinendedich. dollar.WWWWWWWWWwwwwWϾϾϾϾPo0tritwo reime(R,turnounGGGGGGGGGGGGGrskibbe0cdecidhaoy,foOOOOOOOOOOoOOkselfttgWWWWWWWWWWWWWϾϽGAamiabl kind-hPȿh,oso1toWarsumfy`ydidote8zeghtffaislHemQorpon0Fisတ,H׿׿׿׿׿׿׿׿׿׿׿׿׹WaqrkincessXly newCpinxh-ǿǿǿǿǿǿǿǿǿǿǿǿǿƌgeKc!all``+agadisapp#׿׿׿׿׿׿׿׿׿׿׿׿׿paymen߿߿߿߿߿߿߿߿߿߿߿߿߿߿߿߿߿߿߿߿߿߿߿߿߿anldtyle">"I'llendheoneyouo-morrow,Saidhe,henll0atast erful{8,udXHsgsules777777772alibri">ofconomy. OLDATHERORRISw绗???????ϻ?AKETCHROMATURE繧Ǻǹxmarvelatstonishedy ildhood,ٽisneɽ߽߽߽߽߽߽߽߽߽߾߽rememboday{souchntsZoiname߾߽msap.hennewim,XxPd rgy,ettledǾǽv8obscuvillΆEnglP.ȼadnjoyyadvanthsf~a 0eralduca!atrong,riginpowXofPou8,mnipoteimasgenRinb;u`o lyYϸϸϸϽ׾׽deepqhabitissociplrWWWWWWWWWWWWW">countryfr*mselvЦoin:()af????>acquirementsouonlyingleithhem,or unexampledmalgam deliberatelyutsisreatandnouread, ,itheep,umbling heavcumb`alk,utboveyonderful1ulty`"hemmȀkPiess eϽ_ϻϻϻϻϻϻϻϻϼϻHthu9zprotؗQA--emlike ylsePat''''''''''GG'&RIardwhenceBinmidstYones''porcesiarl iuddenhappen{swo,EDmyoguish hrsappr"nChes!7777773ntize="3"acHCalibri">Charles!atherorrisa emmed oorpen!"--annollowed ṻhaveu0XirguisheКZ??ismap0`)Ȓa0gurwniidYousY[musedettouchedGillus!greymomentJ٭appcqrPermysterio>wVmYJinest.uYXJ'''''''''GE="Bookmanldtyle">distance,nheikenessfewnglandillagPwithwhiteeeting Iafaermon thiserhapScripturPoawwwwwwwwwwGoGriswoldRpassoutI,aidHeleev''ȌQfirs0cquain":Pra8,83who pױױױױױױױױױײonxer?Ƕ?;WhyHt)aFaror0.''''''''G''W,)xoddaeniuoo,eclacPinued.Ibeenonder1aXAmornhowȹ#readRBibleоsoittpurpose (topparticupsh0prntXcearimarratpic!squerLazarus.TgtustlQcYJe`alem eaiew,hdou t ,ithsimpli0pLoJesؿuseohirhofwwwwwwwwwwwwwno;ܫ٬w K͞Yachx(gaЭjQ,/">peop(whoimindordeaid;"now, whentame evening,usedoout seeisriendsnethany.L)Jesus㓸disciplesoÚP`s,ithߚߚߚߚߚߚߚߚߚߛߚޓ,SLaza.''''''''''GG'&~rnarratore`oXoell%ed,escrib2earsahokPoice,ږssAyPin9s텈ağdoXomHw!ondбW77Athndupint8bywwwwwwwwwwwwpgraphicinuti深xeyitnPi)poke *rream7777777777WW76!triumphajoyᾳurrectiscene___________׻׺Onpoccass8Hta ablunusuallwﺏsupplJakesweetmeatfounpportunit@o큈ǻǻǻǻǻǻǿǻǼǻpracal HuѪsam@amil0y.ȀthMar0quie''um߻ravior'spyh ws;uʇ77houoxwɷbe8for.췸u fm//listebChr`.o;"'c0Qkmucherv8'--ar!//////////OO/?`Psfryafrerؾg(erb@d.;tize="3"acHCalibri"> rusirc(,all"confnceeeys,ӆ@atwhopwarmoul7unfolded,nheibЌ0ahsecamery1Newngl7777777s.ߞߞߞߞߞߞߣ7777W777777777HoovAevangeٗlowѐfootpfesuoǩǩǩǩǩǮ?Chrx,wellaupowordhrep1`r:Kg𗑰///////storieBwei2|Pvr`0favor0sertooooooǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿǿSommtooX@divenarT8exceedPpracaturn`Xnxampi؀ 8e߾߾߾߾߾߾߾߾߿߾߼___________exdoaȦofflittcirc(t!roci_ggggggggggg>yerhkccasPirst ٧9cecttolbl׾'''''''''GG''audience1Xxrn)"1ferIHdiscixgattendedftr8rr׿ooooooooooonButhomwsPm.4!sai(x8??,arrowfulo.Why,9ckeep}away?erhaps,#ϻϻϻϻϻϻize="3"acHCalibri">saide,lancingၸomefisackwarduditors, "Thomasadot theresittleavidownn ot;&qu0ndow,soonAeveramuel boh8aBm!BWde. 'No,ndeed!' 'Why,ir,' said, 'Iaveholeotullfeaches,n`anngetlfthem'"--here 'soicerewremulous--'becausboys___________^myarishtealmo.ߒ hedon'tirentsϓϓϓϓϓϓϓϓϓϔύO#qto?'2a ver0c9sweat\GGGGGGGGGGggGǓhimIwasfeardyidPFhowoualksaH);נננננננננסנ֒emeQlive Then,;Faror,(r___________running, #kobligepAIZdцjownaG.??Aftthis71ep .dzdzdzdzdzdzdzdzdzǴdzƸ??Our frielesriginh tooHis,natT'or.ut,"dded,ithull-heartedLJdžsatistion, یXordsevernurryhastll ,ut`gggggggggggfnough,orinhabiteeternity.Aerideafinfieeisur almyesourcescarriersermonequaltreng8simplicٟOOOOOOOOOOooONAltHoISseemo⏑nsibl fyngendBoxludicn 0wnodexps himself, z777777777WW77coderarelisumorsoshrewdnrepe.nǸǷpsywalk*aborن xham9its??profa,stoppPbywhopflockIyouthrobat77pl:--//ϹϹϹϹϹϹϿGϹϺϹϹͿFaros, !devil's@ad!ϽϽϽϽϽϽϽϽϽϾϽϊI?ai,nignlyay(onh0,77777777777776nea8trch; (o(f*lldrenWgggggg߿ߺgggg߾߾But2s"sdoZ(gooPXoXdJ߾߾߾߾߾߾߾߾߾߿߾legendehre eغc8be磪P.Heivfaryocomm@agfԝc@inuexwhehad fontize="3"acHCalibri">impairedisowers,oellverndLgainheameiblXtories depЧpxmyyhha@alvaZ'DSin,ooooooooooonsws9iX rtm8doweks 麀frhȠàl.ItBnot yafhathisimplendovingervantf ChristasatherednentoimhomQed.same @fastpassifrremembrance,Raewears, Iory,ikehumb gravwillentirelyown r:forgotte momen,WWWWWWWWWWwwWVthoughhLhabel0!ey " eth//not:s,c}sehee0ai0recious.//////////OO/.'G''mbp:pagebreak/>THEWOLTARSOOOOOOOOOooOOǶǵOR"PICTURESNNE׻׺I. FIBERTY, 1776߻߻߻߻߻߻߻߻߼߻߹ϹϹϹϹϹϹϿϹϺϠwellsweepٲAoȺonhwaslid,arkBjoGϺϹagsreddensky, AlyeruHgo9downٺxǹǹǹǹǹǹǿ'ǹǺǹwest.t"a sk,etPic ȇY;"loqriftssnow/ϼϻblusherims(@dirops`layishade:purpleilac/OOONllows;mYrdshrewd@aZ">pl ,lpeo'soseb opecloakpuffin׿׾back(necqshlrnmistakabHicationatnldtyle">heasettingpteamorealoirnight. woodileGGGGGGGGGGggG>Nxhadeene(to,nomyithisߛߚsr,1pychips,hich,veryodynHȢ`p//////////OO/&oldtimensideredwholesoandhiousmploym,ʆo">peculiaruty}risgeneration.u Q,ahy,)''''''''''GG'mountOHcr0lagstaff,n3ǵǴbusilyypocket ndker`eIccasalexhorQ''''''''''GG'&2 beuqfast. ϼϺ'O,eIll,Z;4byou eveotxonOOOOOOO׼OOooON'em[makeysoXld!ϽwwwwwwwwwwwwϻWWWWWWWWWWwWWϐdon'topsurXumbs!hparesor?мawaI`y,Ǽǻ২)鵉 ertyߺߺߺߺߺߺߺߺߺ߻ߺߡ77777777777772So1HAsould,othdoub tha@er?????????????>Ytyinmsteriouensё8f8shpfGGGGGGGGGGGGGFD; csodQdusecflutndGGGGGGGGGGGBace="Bookmanldtyle">snappednheriskveningind. "Nowee,oA!aidr; Kthereoesyonnet!hatillunt shrewdasheirstPatreeteder doorpened. saucHuprm,fYllepvit*x,籗tvigort-A w,,!ot;heaid,hen,fter while,Hfirpeemednolerablerder, "willounswhmyuestion?dždždždždždždždždžLJdžWhepisick?ۋߌߋ77GonHvٕlotoet!bonnet.O'O____________OHowame!rff$zuMehetabel.Ii၀nqmGGGGGGGGGGggGFenough'O____________O;ant00takP*orimthr`uperty,7d7777777777WW76Gr .߶ߵ7TorPddlck!us8fj'sut-ups; dbwaslly77mi8!?7777777777777??Why,utalagstaخwoodile,Iɻ߻//knowxhatapafingi2,oreon0entlhe___________^sawruiet,lue-eyo r,hoad"lkneoodur versationWWWWWWWWWwwWWWWWWWWWWWWwwWy@smxXh,ncourag(A`w90n?_?︗]wanteYt=myonnet"hiapshoXGGGGGGGGGGGGGF!{t[carriQtff,ndeaid ou`otoorryfXloset--itas8yeringerty."߇߆77Aso,{kDick,hostHbraQaaoplarבבבבבבבבבגבbehitgroup; 3QI`ard鑐ne(@`r'settersmo,thaXʘpvetgaltarL--AA??madPnowoodile礟;Gaboy!Ǯhislwaysemem`your writes.eedgggf,rue___________^eni;Zope,nillxveAdosamߺ777777ϿϺ77W77t;Onlhifa hcapSake϶AupHitQ#߼߼߼߼߼߼߼߼߼߽߼ިBn't$XmOweek--yall77OO׹OR!ll,0I'go`;etoneoat.tlew߹߹߹߹߹߹߿O߹ߺ߹clenȿDaddyarastureot,ytucktopGgreatail}playؗyra besieged77iսt''''''''''G'';O,es!'alwaysaksanyelsatnobohwantsne('Hwarr,owxouftracii]blessednefhemhips." ea.??????????__?WwϺW1I'lllwhecwarovone sonhshe.4I'm777776"0">prettyuchiredfrinkingageea,orne,now." fifteen,nteredithet.hasneeneralxclamatioand "؊l,sai+muchuff ng覐v`ivawY y`OOOOOOOOOOooONstockPsoureservmyselfly;w ײײײײײײײײײ׳ײbe"whbf@pooж@oldit٭GGGGGGGGGGggGFcountry.Ѕllows!makehycsometim`go𿷿amoyhemsep@th8nl)عshoes:f ped9feet,eteerfulhope`# X뿧d @Jb0.χ"spirQfisragemicsڿpicularn,en0ȿ8cHhungyu@inooooooooooooo>tlesstonowy矲. -a_____________houph࠳warm4eak麈up;uexmoؘashton'seneralrders--lit88ooooooo׺ooonitwonxygoodd! Iall olvXh׺wma aȦ(missirHoyth(gHj size="3"acHBookmanldtyle">pickpupplies.fheyomeoou,eedotellhapoo sȵ`y awBstirrh.ec؝0got_''﮷GGGGGG''GGgGG;I'llmyewPcoat,湠XgH!sn'ut7??upeHis,wy?wwwwwwwwwwwwwwwwwwwwwwwwwwwwwNoOWP;TIlayouo`xtednesday,ǿǿǿǿǿǿǿǿǿǿǿǿǿw!DesiremithuHо9Qailo"OOOOOOOOOOOOOW'WresPhoomOH,us=tbedpwo߿߾2Warlankets9Agre1lueuilՆWϹϹϹϹϹϿϹcomforters.henother'sndyoom,woair--four -- workedithosesnllheorners.'veotmoive!"nd grmammatromoodblankets,pattmown,rreatridebtendestasv!ingomethQthat7777777777WW7layeryear!arhbu+nePltered.//ggggggggggg La!r,re'soОof,\saiduhHitty. UseonWWWWWWWWWWwwWyour edSsȞfro;yreust AoowforsoldiѪWWWWWWWWWWwWWNo,ɦan't: 8adyaxwarm;'tisiow___________s'embe,؝*yayufferϻ׻׻׻׻׻׻׻׻׼׻S񆀻}wyuratoricy'Tw(n`ruptb8apпdooJwoenq̿ϿϿϿϿϿϿϿϿϿϿϿϿϿannouncسselvesIcommissionCongressarchuupplies///////g//OO/кNowploickens.ylew`A~direct,--through)`passage,aloomXilk\d!cellaup~chamberherxbordXodithtrioticsfollowBJohn,Ē[GrPhorl2okitchPIŹat'''''''''''''&s(XailerWar@usi@XfquietPsortrrang,MobtravPɔR,augggggggggtize="3"acHBookmanldtyle">contributionshatererecipitatelyaunchedn eitxnloor. "Andine,oo,aidr,othingoubtH,avbeenusyllhe timenulloffrittletocks.gߐߐߐߐߐHerehtoY awhoasaj‘bs؁@aOoooonwide-mou8dck; e'sajargelueyes ed77777777earnestlyrough"tϜoooooo/oOOOOOWǠǠǠǠǠǦǧAuH(ylewt.dGoodnd!"childcrazy.on't kwwwwwww7wwWWWWPmHcouwour--take 'emway!ggggggg'gGGGGDZDᚘwithir8tt@desolation,zbegcryGGGGGGG'''''#I8ntȭgiv1psomeڿH}I'daroarefootnOOOOOOOOOOOOOOnoPllaQn8se8np.߿Gm ,ykWPyoPdier,nderlǿǿǿǿǿǿǿǿǿǿǿǿǘ T1,'(ushbkteiwhat׿׿׿׿׿׿׿׿׿׿׿׿חl8lerlx)em.itنsuchXas߼߼߼߼߼߼߼߼߼߽߼ifHO;y'gls oo ߼߼߼߼߼߼߼߼߼߽߼fonroa'soཐmpleyappySAuHyHlyGGGGGGGGGGggGFmed,--oooooooooooooiEverydyespi0";nooy,ei!!ight="0"> ofmalloom,leasusyandsだmaket,hereneapcheerfulyoungulattooiat qroni table.asket @lfglossy-bosomedhirts, dultlesollarswristb,esidenhichslacxlasXewpemsithv8prx??satis(tionjr↘k-eyboy,uc8romchoolhИioksver hould1st;capY,eo7777777777WW7mo owȘePtheadqc,pwQϮϭicx[/ntirAadmir0on,eposits(??????????__?>italinaeaot--b littleo,hoseandsreyhisimenerylou8condition,0thicipieAtagesfettingpiscuit,--"minute; (heߍggggggggggfquicklreherselfpompaste,,epuMato_rollutYroceetoR0solaAuccoryoungߚggggggggggfmr.oǣOOOOOOOOOooONCNow,enry, ironingable.τττττττττυτΉ''''''''''GG'&"Well,tXkesou1ioney,{ai@delXwife;φnobodyPturnffxatuch)aay.//////////OO/gggPyoPy--thoser'dqceыbneveraany7777777777WW76or2ј o(irooms.'pAitshkindpracticߨߧI'veot,HdEnaal!//////////O//ggT`e觇littloX(a0g8w#familytgOOOOOOOOOOooONbox,0o(qchinaeaJforenamed@Qpoubents׾׾׾׾׾׾׾׾׾׿ם, #we'rettmyyich,ow!ׇ8af`ZXOOOOOOOOOooONHenryisPwunpp3Mamoussne-de-laHress0//carbaby,rogue`hastyirdsAyade~p llariyshܰoceeds.''''''''''GG'ϻϻϻϻϻϻϻϻϻϼϻϫYHPaometgoo,up/,fa;letmљOOOOOOOOOOooONh`whihe'.///////////O/////////g///O//)T0azh਀tonidyesmo\9߻߻߻߻߻߻߻߻߻߼ߡifficult08cu romgrasp;ubeiycould߻߻߻߻߻߻߻߻߻߼"3"ace="Bookmanldtyle">atllnticipateisurpose,eashednmongsmchangeith munchingeryncientrustfread,ccasionallymprovthe b,ndaid, 'Youreoodoy,eorge'--Aheaveealf entered;onefhemdvancing,aidis3@r'sooooooooooonshoulder. "Tzellow,e.WWWWWWWWWWwwWVϑϐYoure restednam=niStates!Xo'wwwwwwwwwwwϛϛϛϛϛϛϛϛϛϜϋ'Gle,hatkis??Sp,rembl777777777WW77Aynotr(rtyMB.,QGeorgiaffic߭OOOOOOOOOOoOODzDZߕI'veeenree,Hrd-workseyears. OOOOOOOOOOooOǼes;utBGednuitopslaveϼϼϼϼϼϼϼϼϼϽϼ϶??????????_??:Shalleescriblea--1sorrowwifdismayed___________^childrtcanguishɲsimplon`, dlyxmha//////////OO/.moola?Pye(fenhbecauȘhlawIink,WWWWWWWWWWWWWVf؋ur=fhappenorcbrorl_____________sl!ϿϿϿϿϿϿϿϿϿϿϿϿϹggggggggggggf *WW'____________\ItadedtoomHe stooraried--t="0">life?--no;utorhe fB--erty! Lawyersurriedondro,zzing,onsultbXng_____^authorities,--allxious,ealJengagedQwhat?oaveߐߐߐߐߐߖߗߖfellow-i mond?ΗHestscape;ggggggGGGGggGuQdeliverimIsl8ry.ԞpoXh'Aeyesߣߣߣߤߍ'o!ainlybusy0ursaffairwhichdimlearnwwwwwWWWWwwWWthisbecrificed--onaltar!Unionqxiϰϰϰϱϰht-breakZanguish,es!8desolatwwwwwwWWWWwwWVTchildrenriØьw-in`mXmen,׽׽׽׾׽bt:Whouo2xnl觹AmericXr_ *WW﹯Ϲ'Agtqa day@inesalkssk[market.SenatpQstates,2()pattic rut!xto߽߽߽߽߽߽߽߽߽߾߽givryntncopdifying[imprXruly߾߽Wuspectacle--Ysal @!llhliminari׾׽scenere;usky8owYos,쿀thd wطul٠(urnr#|teeth,feмarms; poor,ldremb2woRhelpl, half blind,hoseasthiisoeolh0snher P oyithtremgands.usbQ xhves,sterfrieH,llp#be''''''''''GG'&scatxedikehe(afffjthreshfloor, 0kadlyeacorpature'stears;bamo0pmalkskly,P,''''''''''GG'iHpoliticianYXivAmenQlaweQreligiongexceedsp2inoodirits--fwhy?--itn'heyohatreȠ;ton9omebodylse.8soRvercomtableCjѠ8l asuite-of-cours''8ai`sconductto-da9ecidevalu1jud0ousxhibon.___________^Qnoafp`yart{soulsHve8knock@umpe߽GGGGGGGGGggGGsX؀ibyaP`eerXhammeHheph''instripPӣYhusb2Pfa,`awn simprea)JprayAwithRchildren5jong7777777777WW7'{joypohignora@lXareuntry,OOOOOOOOOOooOsQetpDadmonish,mistake__________^NAegtcitementcpressse@)exultaA_______Ǻ_____Xapprob;tٞ@ort9inest8putownǻhatasriedoereean. mbp:pagebreak/>whereurisionsfuralliss탹eezed.ountrysidences,
farm.uchPilCagets! xassur mA0cost߼߼߼߼߼߼߼߼߽߼himlittle--scarcn,eptible,8t缧Ǽ??????߿ߺ??_??;Ied ;fewosa)a??????ww??_??wwwww_\`h`a(uPpeatrexfemh,o,ze="3"acHBookmanldtyle">fromuneill xst,haturnishs yeacheshe,ndisife,
"Well,sohat,on'tpinktcity-bredolks.<13؆_____ߊߊߊߊߋߊHere@brokenithloodfccountsaMr..'seachreesndߊߊߊߊߑ______^Mrs,strawberri1butterpricotetc..<;whihelwwwwgentlelisten2su(aong,eary,nmovquietudpfߗߗߗߗߞ______^visage1terovdeZavehBworstossiblpiniongggg">hjudgm0.wd(ppoint too;Hs reckoI(1~beracticalrmers頂@IadsJH PhusiasЫ''sympyllygPultur designs./////ϸϷ/'IouXchildren,said, aodyʞntHpsaamazin'eap;smuknowow--my׿׾uncsprepocketndkereoufully@up要knѾ׿׾shpjб@rHlyOOOOOOOOOooOO??????????__?>`mterr ylow,tupi!wonderXЮ??????????__?lways ertaisognpiniXsenseggbHxpvidgettinguY(toiwife;Ģjudgmp1notgggggggggggggfhsPbe.߾߾߾߾߾߾߾߾߾߿߾߾߾߾߾߾߾߾߾߾߾߿߾߾Atᾨevs,8rl`b eovP,pplea0, the firstorningnpril,otllemember 造savorf0daymatterswisdom.url`asrettyottage,boutwoiles''''''''''GG''romcity,throundshadeenastefullyaid .herߔߓnockndpaths8rbor@flower hdHndosebushe@1GGGGGGGGGGggGFwhichyxfespeciyeased_littleHlot,סנstrolloffowobrahiPveZPȚ (end?????????__??w"ocow besturج weeprweonppiXenoughg`new~pefhousXntrimnesgoo; HsHng0sal`c -nymHrepaױѽlef8pmleis(apurchr.ȷa8ite@adgivawa1needehep;ahutthulopwantee;bundanc gla0s[ȫn`߽߽߽߽߽߽߽߽߽߾ߠaper`,o9nzcu''hmakbaoomoconpikaX0lptnockupw #Ѕpbe8 .e囉ڵPhrowt8bandowr sȺ),caYw#luck:worwhosqeapsHctualvbfmoney employPm.kbe Rdarlicottagei(ift> uptsadonderfullyorllhisarnishingndurb{.otpeareveryong,nailedheosebushesmyife?watergeraniumbothlatourselves:each ern0!hthriftabx.uoon,ikedamEveooo''Paradise,eulittleomainoskiends8getitshape.ӀPaysH0$, "I oaYdenwhenɠWWWWWWWwwWVcomeextimQ888layaةor;OOOϬ`afȒyIeasikeeworkf1leisuQy.SWWWOPa subl rtan,--EnglHQ,ϸϸϿgggggggggg,s0noblemen'slseecaasgrasshoppeowyҿtalkfؿieat'westegquionpbcarriagriX8ϾϾϾϾϾϾϾϾϾϿϫonservatory;withifficul@enPdtony (t*f:hum0mitsexpecPs:ere8߾߾߾߾߾߾߾߾߿߾>dresxHsCkitcѾC30po0oоǿǾturnip(beetdoiquitescHorim.n0sstrow8s sticrefnѿr uadhwifetooooooooooon`gllrhffromxgrehsquaosbwinw??鬑tPXQlit`nglYeX9sm)pie__p> ofie,ogetherithircles,ound@andariousBgeometricalarietXfunequalled.herDaoooooooooorunh@,an9n,seak0or `dgrePm(,纗/VhAspecim賘 flowepybulbЍIalsǻǺforth8Ain jiionIntQhad 8nccouaǺǻǺarivɧstore; H, aansrivingusinessnarge scale,tnotlwaysonvenieHtoandu`hepgeorverywwwwwwwwwwwvlittletter, buy1th`#ccouaeaagreeabamodefquisiti)sabillsithe' es.WWWWWWWWWWwwWV"Younow8ustvw,aidyfЗmornYHoured//////////OO/.week.τfrd:garden9whdorkedurat9ǤǤǤǤǤǤǤǤǤǥǤtwoolx8ayisؤimomq` 77emency.entȓĥBȍ!@sell--axnderfulealnglishd.ȇ oui9hanyPney,''xcep"obliparticu@ls;HpatronimshꦲͽPtyumuchwerҔ!hǿǾaspXilthcomssol(Ѯ׼׼׼׼׼׼׼׼׼׽׸zWhmakes:shXhet way?apprehensivelyshserv8irestYbeaоsundrydeHsti@sornIxphhe's tle.GGGGGGGGGGggGOOOOOOOOOOoOOMardenlu^2xanim9anlWWWWWWWWWWwwWWsofrs+4iad-maitOOOOOOOOOOooONvouxffecnseq9 pqembarrassmxewosiI.׼__________^Oldtyle">hadaithoelievelmostnyhingtIsime,dereforeame milk.toodentry,ndfheadyher ad,mtick; getsccustomedos,tilletter."ׅׅׅׅׅׅׅׅׅ׆ׅ֊//////////OO/.MadamashereforenstallinrXyastulot,ndyhfבאcemplatwithleasicsqueffectfappearance,//////////OO/.recliningn greenlopeц,r ndankleeepߞߝiDurggr؅‡gundadowsts.WWWWWWWWWWwwWVSȚnsow,hichayoun@par@ Qߪߪߪߪߪߪߪߪߪ߫ߪޘsP;BthisPnsiatih0pir Brde OOOOOOOOOOooOndulgeб wardsfoiblOϺ>Bu@hXIatiddyu8nev!ucceZ tQn@inϼϻWeㆊany1Zss1YmilЫpsǽǽǽǽǽǽǽǽǽǾǰequyigorous HsonalxeroriQ,atterϽϽϽϽϽϽϽϽϽϾϽwoaeeriasp{Ieg`toeel tevnd׾׽appre.t hyelltalkleasmaiϾϽgoRbalfhneurxawn;ymaginpooǾǽfPowll ѷbYndrizzly,ai4ÛppHhimselfr scamghwetorhxtXHaxa!nmadamstablish`aegula߾߾߾߾߾߾߾߾߿߾ߦcises,ihabeoxbewﺇmanldtyle">suffererselfoeaptured;s,irst,heoustation h0IPt ePypy;˓`adie[heqoeon7/////////OO//el`o,wipqsweatromrowt0A`asOOOOOOOOOOooONpayIdearٺeccentricigenius.Teert0lG/////////OO//,BbessurprisѴlitP ѺtalsquPϻ777777777WW77extraordryenc(hBpxkewn;8reght="13">
thaXheounoto.Ӏtppicketsffgardenence her<憗>pleasure,singornssandilyYIus(lawmmer.ooooWevhadPmind,herter)bitencabbageόόόϓ_______^,rrunVatchforagexpeditioatoiOOOOߙߙߙߙߙߚߙflooprs,2mad@xelfqualhwelcomXșy`uchǙǙǙǠWWWWWWwwWVscamperIdrivIcrie "Suk:e{Ҁסs~constantgreetedura keptzlittleXblishme877ommo!.tastnonIalung®skirڮǵǴmyewroadclothrocka1carഐflap`g,y777777WW7atirgavuvarioudvurw-clxf0ddItopeakZthreaenercoolXsubjecknobody8emdispobo⽪ecipP8:pibiies.nwwwwwwwwwww`pIrglapxgetiftehdoll(׾//////////O//*my0ftkٓʧ e(Xw`y-five??}w(hexpe transactionrsah(//f ercisen> alsoX`wowa@rn9roposoyP''mosxpvmopchargRablishmoetenow''''''''''GG'heZranyndi оerȽdIb77dy3ceYswarm8sH.____________]Accordly,Bafoon, ʸ[deepYarticlehatas preparingoreorthmeric`Review,ntelligence!rou@e~"awarmadisen.naler0tce,ndiscovered,0''goout,provokcreaturesbchoh*topfPtreabXPirtyeethxettle.wyparefullyϙϙϙϙϙϙϙϙϙϚϙinstructedusXPapacpSmiaewWWWWWWWWWWwwWVhive;InecHemplaIossibili'be0,ߦߦߦߦߦߦߦߦߦߧߦlikea'sallows,9cubitPlȎHdeiqlyp{ooooooooooonsmooth-bark,hiHr, a@lumnHwenThPbranHwig. "WIisbeone?aidɭppetwoh_׺׺׺׺׺׺׺׺׺׻׺">n9bors.tas recommendatiH tmpddh8ra`dga;*,quids!sidm߻ߺclHexaneil heaa YlPhgl@s@ϺϺϺϺϺϺϺϺϺϻϺϭI >awxgirdYofn[//Psettle(0ityropas,milarltoods._OOOOOOOOOOooONAsYesul)`oeuvr fidious0q ecp/////////OO//lengflyAtalsekeepiwtk77ejoicsuccesRJtwnqarticlWOOOOOOOOOooOOThatveningyifendpeanuroneysucklrbor,pth sHryfusiQSaItCadish@nlantG77>broadcascarrots Qrrangedls9cawhopap@Ț Ae1:_bodily.yool?777777777WW77uncle o,omewYm/made팠 qhisimasgggggggggg"3"ace="Bookmanldtyle">greatlyistressedndc0alizbyheppearancefurarden.ut, "'Tain'tyyrewreednephew,kaie3yetɵnǻǻǻǻǻǻǻǻǻǼǻayshe'gllikelyeritturbeyHrthItyǻǻǻǻǻǻǻǻǻǼǻdollarsnyoyHPiAyrshiDurham߼߻hallquiwelcomor.ϻϺWnk(himsnutyd{thouBifwfu>p-fadotHnos xdngoodill7?''߹߹߹߹߹߹߿?߹ߺ߹Anow, aAgardenginnthrivxndػG773owepMaylɘ8pbloom,y@feJIGGGGGGGGGggGFȼȋinkselveParadise.utlas!heam(unndain thatarmedurruiHflowersroupomearth,iklkygnomes,as8rrayfurple-leav`weed(almoPi''seetooverwholrцٓ)garden↸.ώPothbeingonexXwasxpectbe(ye--Ycanticiparelaxationsmyei0es.נן//"Well,[xid,replyaentim*s0wifPCwh m//Picsinished,'llaaɤlIan.۱oooooooooooǵǵǵǵǵǵǵǵǵǶǵǵThusslippbyxilengthdetcaIOOOOOOOOOOooONproccஃ.maznt!h1uh ossibfore@nrWWWWWWWWWWwwWnhie0hPgrowo8fewj!hew)noGGGGGGGGGGggGounds,!ey[qdistinc¼beetcarrotJ7777777777WW77ulؤcongregPs0dbobbм???????????_??">mornAbreezh`ifsa@peou!r--we'got??????????_??8H,! Igexpl{@hogh!dbodyverr 8neglectXrsX,k`hisackChsuѧ0sEynHesҺ`feelGGGGGGGGGGGGGy[ir`IbsweaZed!,h hxoncame‹ѹxulfaitoilonpth(Ҵ;҇(ϺϺϺ"> Andowisconsolate@edheoodeed,xusnexpectedlyelivered<13fromtshelteringares,`laidpenoroilJusun!ņy77juvenileeet"carrotXy捀own,ixd*droopȇsf,ike'''''ϔϓmeqeyadninsteofed.ooooo"This Xqui(ariomatH,kImyfe; ;y`toooooiIustXve(lpbout!ooooooר?????ǮǮǮǮǯǮǐאJwh I`myselfinkdu.tMowerorders (GGGGGϵϵϵϵ϶ϵallh fusiopetuniaound8o mpleteoxgrtǵǵǵǵǼOOOOOooONnobodoudream˩B8eeaforϻϻzInortXظagrt(n ѳanXafdxpenswwwwwwwwwwwXaull-Үxnkeepurl`;ejrenHce vesbyRadditпaa0yXriskgsromvicinita777777o77WW77pitchuph0Ihappy. "theldecidedlyϻϻϻϻϻϻϻϻϻϼϻquickartɫXoneenomadeuchclearx*ga ȸdeled. af bQpp0HviewځAନssed/////////////uiJceler@tPsham P0!snx,until,8 amina,HdiscɌ鸙d,ۮGGGGGGGGGGggGG>imi@tpҧٴP0vegetables.GGDiveight="13"> <Ȅ_________Thisopefuleginningasollowedpyuccessionfroceedpsߊߊߊߊߊߊߋߊwhichhouxbeecord(forhenstruct4allhoeek"help________^fromrboys.u0aoser=tools,reatndm;hXinvariableeaver-~gate@lettdowbars'''~personifical nnarchiluck,adee//bexHnest.ȡptime,iIRgonecitya//aexy ȍhXwithoostLfencsw0ǭǭDz??makApoplaristle3cdren0unegg'''hAfruitppiQa,Ylaccomplishment@certainqebued.f*boutؕ0st׻׺`djoiPganȠ0onclumissas TϻϺirmdoȭi."Th(susttakcare,aid, Innotot. 'Tyof'' qu.dAXsq1securGGGGGGGGGGggG?''''''''''G''%B(ImPaostorymayaѧrusympaǻ'''''''''GG''>myeaders.imoufail ptell{ress0`ifohtлOOOOOOOOOOooODžyupon--8cowsrihupyoorilk;Ihens:n'??????????__??set allsn,espawjhson:Pone egg;fnshat,aving8tchedmilies,trawaythemntoall nerPrassndeed@byhicheanumerousoucks??caurematureoldperis(;how,enɀ@itanifptoil!driv`one hsepconsiderateadPs"op, >tea@hpdomesticbitp 0samewnponjislewveryg鞠nA;yigsalsactisagymnaWצצצצצצצצקצxercises(zfencmpy,maraudgarden.ɦǭGGGGGGGGGggGFwonourinpP a,is|Oϳϳϳϳϳϳϳϳϴϳplop;ohertainlyyuiaecdleve׺WWWWWWWWWwwWtQPn9upRearth.OϿϿϿϿϿϿϿϿϿϿϿϿνǾǽWautumnj,ɽXyoberao)ket,n borciTǾǽbtotato0psik8nyﷸr9,etweqllǽǽǽǽǽǽǽǽǽǾǽvariousystemfDpursuedabligosm_߽߽߽߽߽߽߽߽߾߽firhorulxalf(t"gfailure.utwϽϽϽϽϽϽϽϽϾϽ>rvxonsddllus,some yubstantialweties.y eHstor0s,oot8"oolpexamplЌrunomouʙperfunaccable;n''w mxXmsucHhorshoe,rriag߽߽߽߽߽߽߽߽߽߾߽mend`--ɽhwhov|:p!dibn /div> musteeisehiclendppurtenances.alwaysridedyselfn<13/beingxact x,zsettleveryccount,reatmall,ith//theooutf oyear;
tseason8fsorelyutǔǓotnٌnotreceivaimliftromh@odun0,?????__?>Ihouhaved omplete kown.ԍgentlep'swroublesomebicipherdalculat8,@ems+lhimwwwwwwefhaxIas¡R0inmoney-makIO>nork8possessuchurplus(venu0oeeeehK77gPplh;,Ireuie)paid@sɴdiscoewhefteanx0𴉛!sl؛H@кoh8askz"tensi9G??????????__?>"H(riall,IyifP'lheapLcountryhodystnoww.'ϻ7W77mbp:page/> chairs,olishedyearsfare;lutteringithickgleamn8rklfncifulayetyverÐQ'''ϔϓperpendicular,ombr8clock,hich,oughtim apently77oaxalmosHogamilstill nu@itsnevitabltXsorcuryee.WWWߥߥߥߥߥߥߦߥޣ7777777WW76Ohȩruga0utstretcareat,zy-lP,alteseXt77߱߰dJnjoyg PbthfeuphisHbsزhGGGGGGGggGFsleepioжYashж)Xeyf잹iǾǽluxuriouszemplation777777777WW77o''BuѬcharactericiguiwholeicp"1oagxwoIoquieqrjo froiry_77`clarou¹Xibs.haˤuty/////////OO/.ci@--sily [rusnЫ`Qsnowggggggggggbor٘XAcap.ņ:linqurrowh `somPaofoQQssuxhsۚPresp8lmce>shoP/-ns[owe@ftorm)lus7ptǻ߻߻߻߻߻߻߻߻߼߻߻>Onheound,reen-coveredableesideerayrquietompanionf attractivHandjmuchnedoriswnood.elwaysrewcomyboutmsoneyXawslies[windispensaX8y//wherXody;Riteedsteadyad*firmrveorsa scapeuin.ǘǘǘǘǘǘǘǘǘǙǘƝ??Harry'soursecolleghough lliascholarship,pbeenriticalZpeousiacideavoXithPeIultnd77tudents;etequirareat pofhrinkingJadroitwwwwwwwwwwwvagemxpar`instructorsip@8rBQinf1fA ropriet:othAeབྷleasalifbpsom8xempulsooooooooooonPxoxTsity,Clway8umbl<,`ckheelinto___________ϋȼ`scrmaQzarcelipiece(GGGGGGGGGGggGoiXiefgooOOOOOOOOOOooOOOOOOOOOOOOooOOWIallppreed1ersةsay[spalooooooooooon/)lad@;HthanfesxɗmosOOOOOOOOOOooONacquaancѯI`ᣀdozensitablrek??????????__?>well-to-doou(esi femalehsLer??orXitiate3watXpos9doorG//v@,eteforeimllatesndassaghseemedolypenf tprwnccord.everless, wasn@sativeillnewwwwwwwwwwwvquietaid@who`Xal0ereyatouunlockheartreturn,carrisilentԎ)spe`ߓwwwwwwwwwwwvfett hlliant,styirit;s it,Iߚߙhou(ful@owd0castyeГmxawouric8e,ndingGGGGGGGGGGggGFolwithmo.TȜyHzidolatry.ӣh ian''''''''''GG'&impersoobگ+wohood,0llowȝRainteG׷׶by @yHsdomZsor`Ya ·aautiunhOOOOOOOOOOooOfrotecternZvener lEl 9seem___________e8pmosacrevceob@0@*IofwwwwwwwwwwwIorȅܽwhic`xadledg窿">NeplaangHqhX Mdthree--alittlelounoigA(n`'snrisxoriz//߿xopeyet@inburupPdark:dr0,a777777777WW77fuy׽׼~IiosecQcogilarit@2HarryJbeso77indispensa @,oeticPn(u Pf0lyirculateȺȺpan> oftenmidhelushfonversation,ngenialxciteme0X㆏hour, adrankreer"deepXth(wasest.wwwwwwwwwvGGϐϐϐϐϐϐϐϑϐHeaid,tsrue,tcaredothingor0xрϐϗWWWWWWWWwwWVtoim7neffecthAallXose؇youP__always8yh0 cupCircebeginn1itsorkithimםGGGGGGGGggGGFrienderexnoyebecamxious,emonstra;ujlaughxat??ǪǪǪǪǪǪǪǫǓw0rearinsisIonnowɔself;tXs@ a////////OO/.sudd0startbshi@hmornatur 0awaken0gdreadful HcepEdangeqresolv{decid ndOO׽׽׽׽׽׽׽׾׆Oetermieqance.urs!io୑@CincȽ߾߽Hablishinsinesttiq(temɾ7777777777WW76remXaP0succfd y߹߹߹߹߹߿G߹߹ߺ߹ߠtrengnu;eetpeeche'Wmode;firsXdrpatrЧuppors;O//quivocXveemHlly Abeg''vobociety.ɴ(uc `affa,9sign٠g?pledgHkeepXeasĚtsca8enWWWWWWWWWwwWVorelt;offxglanalirclxmetWWWWWWWWWwwWVattracznowflІthphapppso皐txeight="0">dangerasilyndompletely. decl`.ͅ.maeloquyechAeaanowrϽϼgasAl.as0ious Psouts,haps,𢡊ecarritoorladi9aryitop߾Ͼ9dbPgettɲ castuff;: -yne߿߾cupglbacky0circlqsf, sobxsecozImunitXXvi@ax@unjustlyelP7Ͻϼ纏TxesopJhistoryfeform,i qo缯ϽϼinidualdangerYwÛems irehp.slo aqkЍhealthig,8tрbHwillfontize="3"acHBookmanldtyle">undergoheosteroicelf-denial;uteimncej)own beginn1iyAnt[A.'SBp''''''''''G'''''''''__''G''/;Well,rPpainks0on'to,@embɤػ//Oempnce`cie--I0aⷜ,iHdoyself'GGGGGGGGGgGG'ߺTh8anyood0rt,y bxwho8wavieworaϻϺquesPnsqrhraseology--jr0u񺯺ϻface="Bookmanldtyle">"do.K dmewq.erufreeasyrd,orgױױױױױױױױױײױ׶)peoplfrcquaintaHh(KavoritRWWWWWWWWWWwwWdx0cavisitorWWWWWWWWWwwWWOOOOOOOOOOooONDur qtemperem,Kbrha׻OOOOOOOOOooOOgiv@iB@odecupportS\--alwaysqily''''''''''GG''nlisanXoodHvept--sympdrmXiendesGGGGGGGGGGggGGTxgrefault),tootnYضhgXlenessOOOOOOOOOOooON:Pself-r pciHvirtuQmux7777777777WW76resXm ylit own1victionhnGGGGGGGGGGggGGhosldwHtohdIcaД9eyXoHstGGGGGGGGGGggGFpowмk+who ЭQlyyoudgQopxonsGGGGGGGGGGggGFinsensibtroll`m.otwith0nd,RѡӾ߾߾߾߾߾߾߾߾߾߿="3"ace="Bookmanldtyle">acquiredreatnfluenceveroungen,ndarryadnd Itasmost lliapartyeason.ŖyсgotpooooooooooללfaultlesasteMrs..jinZspirit1it.ԗPgirlsOONwСokqbeautifully;rooms "splendidʁenoughwwwwwwwwwwwߩߩntoouchlQ2mthalldoA(ir toߩߩߩߩߩߩߩߩߩߪGGFase"ber.moǩnsualӔp(twwwwwwwwww߶߶out8mself.י!miyֱhou"JuѤokay,onevir)1; @h`jP~beenusromuropļ PaenuiHicle.ϑYounow'm ٵatne,a colorp//Why?w08ouladta*0lasszOp(temperance Hdg!ma'''''''''''''rderpeapostle; weooroǼǼǼǼǼǼǼǼǼǽǼǸot;Pshathos'&sekYrob, 'somengfontize="3"acHBookmanldtyle">musty,'"aidayirl. rh*0athrɥ0bservscs;uph??did+y.balanceoimwOOOOOOOOOOOOOwrYHshbycpa:laugҤQcolor8,!drankOOOOOOOOOooON--wXhasbharm?ϵpkillsbodnϻyfxf0Pxʤ\@PciplGGGGGGGGGggGG+nscie`,Zdrop(yqpoisPE`"777777777WW77''Harxfel@ɻ 9arerternaidivenheight="13"> way;orashatlasYenly(eevening;nor,Hdn<>rollowed;ispiritsoseith:wixafrishayety777777WW76incidetoJexcitablemperam茋w!hadeen(gunnהדsocifadiescompletedte `nQleP'Paloon.OOOOOOooONǟǞNobodyrnew, thoubrecogndŸIpar77forRundcHyoung Xqd pot1.romcؤtruggؗmoralxsistanc0fatalimpair᫈㬨yielde??outes0efis,(graduZeachϹϸgreweaky)ؔmhesolutionOggginihnt;:relA 9frd8mbrfxemselvھyg9ongoҌnexHeekrpH.k1ou`dooiv@+sbecauhjG.2Rxlas[{noIcomOhit./////////////.77InbaParfڣAG.'sg`@iLlambhabiof//////////OO/. iroukunconscious0wonderowu a朇7">Cbe lrayϻ'Harwadeciddesperatxature;isfecti׹׹׹׹p height="0">moralenseagediercyrithheerriblHyrant--madness
ctubendI(æPpz.oEllen!Hfe'sOOOOOOOOOOooO'hPdXnithtwoHlЭAikenOOOOOOOOOOooOOOOOOOOOOOOooONA(mxathippen?--nadoHjtju suc߾___________ɜamous媐yay. dyda??????????__?_hous wayos lik?rؿ+Y?77ronsibilit awho (bRuardian6safe(t> purityfhe(rex,ovoidpttingefore9mbtemptation`&whichotenno(tally hoodasielded?hatsaltryw''considerK8fash,omparedQsafeSs,rrPhusbs?ԓgreatest0ultAwo%slaveryqcustom;yet'''''''''GG'houtӓkest?not usagTsolitpociymwork (JPlet:m ?">sistthinkMKC9 ose HiѧrangPirnfluenceB0j1selveHwh8:oulessn /////////OO/.yissuxaffec]@`"BehoXth!--_[칷'׺׹THEORALING.ooooooooooo_777777777W775 @nilifn0ichougirl`sorQlXelfishggggggg׺gggfasromifteawenty,iddwardshton,eerately8s@߻ߺdown⻈hadreadleaned`2cȻtableGJYouHsulrfellow plia@ll, lliant-lc(turпWWWWWWWWWWWWWVwhlonttohbhbonDickens'astorksW?????????????//////////OO/ruth,oz,or atg`IgleHithaif⑿____Xpeight="0">meansorovokeiscussion. housewiferyxcellence.ndaitnammafheaseadache,nd

areoodor--justomuseourselves,otherplHrettynd<㆏begreeable."~OO׏׏׏׏׏׏׏א׏ֈWellfeehavePllI nt!0amin ooooooooonfly--Ion'tnow--yet,kaidloce,8ghing, cI often????????__?>haortagudeaqsomet!eratamAc;GGϣϣϣϣϣϣϣϤϣreallwimpis expectedyus?;elcHdo?oooooooooo?ǮǮǮǮǮǮǮǮǯǮǞI xnld-fashionnovboutadiesisitq`(ckwwwwwwwwww@poorrepliHEdward.DYoumembCoelebnearch)a77777777WW76Wife______ǿǺ____o׾o;Ye0truly;+`(sa@Itory٩it#O7">lcenes;asor Ⱥo`everlaszconpsats1Dr.Barlow,r.xanlenobodybspo2skippY,course.¨UڨZendU*awwwwwwwwwwww>seemewePa#eeyo(inaicturesquǻ?????????__??cottag half rgrownithysuckl(findnmaciated,igggggggggggtibeautifuloiproupPcomodr??????????__?>matt(p pokbo8eviIdirtyɍZenhlittlarkoomQmihpg@njhildrengeight="13">
smellingodfishndnions,bnobodynowshat--deare,ybenevolencelwaysvaporateseforeethrough.'d herayߌߌߌߌߌߍߌߋfiveollars0tot 8pmyself.hets,ooooooonPthaneifancy0rrvPthisiYfing."יייייךי֗ߗߗߗߞ//////OO/.WP,rant,0en1you3noꀸow-creaturesunlessainostnteecomtablЦ0ߤߤߤ߫//////OO/.picquanHossiZP otgAe aolikewwwwDZDZDZDZDZDzDZƒ,l(nkinfluov associ1?ןtaXtw________yconsat,Mct[-ɔaladyiftxayѶ#;hoosppnowi9'''''''''''''exerithyhomsurhnded?߼߼߼߼߼߼߼߼߼߽߼߲I\uPat,@plied.yNowmemb eiarkMr.Ƶd Hn@~oreligiousrvices church''ǹ';Yes,o;Inn(aooad.ǿǿǿǿǿǿǿǿǿǿǿǿǥA"doJsup2IonfҽPi`Jo(2didϾϽ thinkooo;utetheatterasllassedvithmiles, andnotႨnglenHuationatadaidnyhHnpleaorisagreeable."Well,Acouweo?nAeswatoeude,ounowǖ;Do!Ê҉P,lorencDwhovewaysakee dxsociety,@؅be xfDbe99saydo//aZe--Lshownimkthos0emarkshreq(HsecidedlscertainwdoifYy''''''''''GG'&relaIcharacaofQr0xrroY?oyindhǼǻo)trueoraleelXcodself!muchul0h` igionrewithqtemptQ ??@.Ě2"ypoisivyKj?????????????>aqrestr@npKguar@sacredness0hȋj9holy?šXehmGFortesque,infl s,r(ᒱ8rmIda*trifl/ϻϺ ubjects."ϿϿϿϿϿϿϿϿϿϿϿϿϿνǾǽ-oserr󖱪 aenco,kyeswwwwwwwwwwwvRqthroughears.??0">"Imurehatouaysust,ousin,ndetaveeverhoughtf self-controlnoughoreventisecoming 8firmedntemperate ??Irreaofh,epliHFlorence. knewXaeasggpiritandree, Ȇsociety,excitable;utLsuspecwwwwwwwwwwanybeyPǛǟߟߟߟߟߟߟߟߟߟߠߦW;Ellioasactkappear ladies'henin`haithtOKEdward;Դ¯9Mcdo߿߿߿߿߿߿߿߿߿߿߿߿߮wtth;0eimadmires,\in0positiwhichould forbidiseelingngry;erson,ousi@whomave(ardnayermomentsayha@henewowoanipleasedithoutoffendyody."77ooooooooooonOdw![PFlorenceqX@; [doot upyoolish??????????__?>speechesgainstPand aksfouainterfereQsףףףףףףףףףפםOat,hr@deIaniit.`never erld,@amGGGGGGGGGGggGFcertІj_oooooooooooo_dzdzdzdzdzdzdzdzdzǴdzǝ_;Aso,Od,youdzǮso `DsϺϺϺϺϺϺϺϺϺϻϺnonelse, hdarhS--gonZ ׺׺׺׺׺׺׺׺׺׻׺labssurah)wnowersf,Pkrtrythaten@blegenerouspe`v@byYouGGGGGGGGGGggGFbeHwilliventuarexdealQsakhfHuyOOOOOOOOOOooONselطwinndmiration;utb adȽߺѓpurpose.o"eowconfirmIishnesawomen?׼׼׼׼׼׼׼׼׼׽׼׷'B䛰temember,ζs att誐licacy.'wwwwwwwwwwww'ǻǻǻǻǻǻǻǻǻǼǻNj'Trcharm!cover-all!9Qases,libri">Florence.ow,eresine,oble-spiritedoung ,wayromis mot(ndstersgmamilie(whoaform,temp,etrayQalmostouiipewordsÍh,ai؎wo)knowsow9shm,dbelvation.utilloldly????>lnemo destruc)causeJhaveuchwdelicacak heft--li9thatupnotloooooooנo>nboofZwaVhaevQqhonf0צצצצצצ׬?׭____^introd[."ǫǫǫǫǫǫDZ/DzOOOON㡈,dwarconsidpeculiar)astidiouslli0is--jeal׶׶׶׶׶׶׼?׽____^ytaigu缧Ǽoooooo߿ߺoooo;Ajuy:reasi men9acqu8tanceanqdothingth*warma02sac(nd~pow charm,f yhe weϺ?ɓa +tAxr--true;BhaHeavgi1tw׻׺iaine(eyes_Zs?ȆȔ枑seen,thxtimes,qeenten7777777777WW76impertоerfereXarta@hcxo Y//////////OO/.flҦexpPsi romlipsan?׽׽׽׽׽׽׽׽׽׾׽׸_________\ntize="3"acHBookmanldtyle">"Well,ut,ousin,hatouXyouaveeo?ow׀o Flnc@marchl9int@grmtful.׻kWell,ousin,qid, IK.Ԋ*a`eral''''''''''GG'&ascripfower,e0mattetȼ(׻׻׻׻׻׻׻"ace="Calibri">experiment." poirr𠱵aƯؚ/߻ߺhead._____________^??????????__?>Edw(sht8o8bachelȢsifƀxe'8hav077777777ce="Calibri">earnedheitlefddity,neneralocieavailhimsel`fto ki؄aalP,bPfXolHowdPnoygHour@purpose; must2 theiamondnrosom,hicheflected Qlnoo PyWWWWWWWWWWwwWV`rklingaysvXtobsorbt.Ӈ`had,beure,lfearnest,jxint Xaanterh,latonic @tfriendshipithooooooooooonGeorgellioanceridden,ȆasketchIim;utos0twentyroHen;jascom!nyРzsuauick, @@lessreat2ouا//avetakeHitzeyala(sodaa(.o; ppdecidedlyoҮcase.//////////OO/."What0curiousȜis!aid8ȤXwf___________heydCgeiWWWWWWWWWwwWW??zIɺkn',O Ryfullysdrew黱f___________^pointȳAralpose0;gola+Т red-z___________^s.omnow,'A bAqmyHrvicWWWWWWWWWWwwWVit.cG߽GADo,adyir,tretchut@hP1Qظ_׽׼_ZKJnkifsake(HpledgImus beyOOOOOOOOOOOOONwevermHdsɒXypon(itsameWggggggggf> poisonedǩa .șurPuicklyh߰asidњ0buslaugRalk(round7777777o77nobodywbsuddenQrP`flush8ȷ`sordsrodu(ϽǾǽlpnestlyUlady's.Ӈymil*ointe?????????__??playful9r;P(l,R`exssionagitatihichqouxn`reʙǺ?elhowe t nerᡐ;/0gl8wacrowtoozarmHol ǺǺǺǺǺǺǿǺǻǓye@ixpwb!disapped.ǹǹǹǹǹǹǿgǹǺǹƾ??Itbl`IImPspec--8@(xmh''''''''''GG''ifwdanger?c9firthoHtsfla辈hHg2GGGGGGGGGGggGFmind.owraYxy soomgiv@uplosPto________ce="Calibri">theyefvery ern,efore beginsouspectimself!his torouphoeollecte؀nd,ePsuddenly: uphe??ElliotxtandAinbstraھn!Awindowо''''''''''GG'&ixoPinbalconywwwwwwwwwwwHesfend`a6t;wdoc?orc?GGGGGGGGggGGm8ifehav@ria򾡿ng-- ooq.risgiv@flesrnQs,y@timeThillXul'''''''!"Calibri">notuteelremulous,hen,womentsfter,lliapproacheder

"Then,[aidlorence, doohrinkromoinghatsfhandARTNDATURE'ﺗ"Now,irls,aidrs.sreyiauers, ae_?from DSombeBnXeekoɈveouGGGGGGGGGGggGairarnX.׹׹׹׹׹׹׿׹׺קO//////////O//זWS?dan,Pp Zembropry; what8_߾me8b,ammaD_^t>

dauher,ndheelicateheekfannyhowediomewhatxeper&asXepokeyweonithrmbroiderynhlence.G׌׌׌׌׌׌׌׌׍׌֊/////////OO/.Mrs.reyadeeneft,yaPhusb`,leuardiof'טחAthreirlshoseamesveppearxpage.ӒIan77ctivPbusy0mbitiouoX,e!sortorymothingsvǥǤ>finidno r fectAoutxfewoups+das,/////////OO/emendans;aHopPalwaysak!yffairﱟ">eduH, Ϡmade錡life'nprito0p@djust'''''''''GG''"ettx char %ˡhweنȸunhstood eeЍinclubgggggggggggW(,igur`dres!ccompltellHmornpial׿׾item@miHih8t.gggggggggggggf7777777777WW76dehthatלpb1meҽ''''''''''GG''ltog8moXay˖rdlyeconxte''''''''''GG'&tra0ngetwoldestڶzeaf,every c'''''''''GG''`origin/wro(ȷ(Om.irGGGGGGGGGGggGponfeelar!instepgusaturally7777777777WW7grom#qeI mo0approvhauity,//////////OO/,">diligentlyomparedndevised.mma,heldest,asmposing, showyirl,fomensiderablealh,shadeens(uouslytraintoakeensatioxwoXabHtyintellect.ermiЋfi(dithformˆllrts2ubjhs,uchwwwwwwwwwwwvfasterpmpowo䚸strmployt;ҚYst arhi//>hambiusor*set xraabovrange(ǡǠieqe0Кef@tJkeepYup??????????__?>iIarQkou 鮰reed, "If--*ireȓordinaryevel ;۵ʡ󴧴ǵǴsox `l rؼ׻׺circumriЅ({xtenoughnone's)dche߻ߺo.~Isabaʰda Pap8excnce,beauty--al,Whkl,leopatra-lygirlhosPlo0dazzy׽perbigumpbiPefiaafurnishHharm;wwwwwwwwwwwvnr@leserdesའgabdri('''''''''GG''>oeuvrsmembersx`comy.œlips߽߼la،AXir ssonyotisculptȶgwwwwwwwwwwwlimbɅinton@silRvoiqstudi׽׼onsiderrectnfastidious coudiscern nothinghatas nt.henereddedll0ersfellesooooooooooonlettres--eapprovruPqdel!withusic,׍׌pai2,ndoetry`lastqcametourcinent;7777777777WW76travhI generysid8orpumicetone,orrubb"ownvarnishcgiv{erych0hater.??wwwwwwwwwwwvDurtiꤰisoqon,issanny,hom`owdeclaherЖhhadȪgrowupKquietudfer'coun`eat;Pirls ap,ЗfxnAmagd.ӷ1air,lenғ8iarityپOOOOOOOOOOooONsimplicɰppeXncwhicift(titsel)autwwwwwwwwwwwbexeffecmn8y)eng)ht'gggggggggggflQso+BifulIlovable.Ȥ8 ingggggggggggfpreciseor`po`C?;irxAchieflementooooooooooon!feel8;toadd8ncpfervot,thusiasmXmoupǿǾ? eȞ"geniusjucommonnPenoughkeeplϾϾϾϾϾϾϾϾϾϿϾ">oryouhavegooddeaQmiPFannyreyᆵϿϾDп8lyass0AdaysddabП`mo8l9out thoughtfulerompass,heangerwn songpaintedlowerandketchlpscapesromature,isiociablyllvxtvillagwXxwasreatvorH,about77thrцJfieldfenceirnBwoodsithRlittPcott𓯓ϔϓbonnet*Pb@,uilt-as0s%air/??????????_??">anyodyo(lpum䟈icheink+happiesǡǠcircumsta٥Huation.GGGGGGGGGGggGFBxaffo(a yiffaspectnrs.reyndaI0e@nEuropfPfPig 豩no1s7777777777WW76peopfrtifi@lharac`eneroėW?????????__????PoFan)delugarrnewdeas;heardsY77pp)beauty, X?9onsb,qs1aso8ir8aǺǺǺǺǺǺǺǺǺǻǝϝicular;urundrfiftyproducingߺߺߺߺߺߺߺߺߺ߻ߺimpress@--shorieemHtor qb wonderX sequeaveoQyngsɀQk3oaybout''''''''''GG'&how:why e*#`Ͻooooooooooo//////////OO/.Mrs.repwh1d*ydoubʣowHbilimakȣ׼׻>chctePHertȪpoiطSasystematicallysneould undertakeoAover (o(dress.ooranny,hoad7777777777WW77nconquerablesiontrying؆ce0rettlpointsgmilerae@throughithostxemplaryeekn`ireߒߒߒߒߒߒߒߒߒߓߒtransfor!h`ternals;utenr@Greyrselft___________^workpind,@daHscopinЀpthetPecameomewh>moreriouh`buoyafee2)fancifulempf9___________^characweincaphbebrgeccordruhrkBwaAdropX~stru0oeckl`qdPs,ooooooooooongayloud*made;artificialloXS؈(rm׹׹׹׹׹׹׹׹׹׺׹natur(desJwnseHerfXyY'7Qr'sgime;rbstiHeie "FannyismsouXalwaysupǺihead0`fiHreceivPcustom;aizsirsϺϺϺϺϺϺϿϺϻϺpatic`y8m0e`doXatouE,p?8chבf.ϾϽAtrylaboXHcon0mQPHhichzdaisetϽϽϽϽϽϽϽϽϽϾϽbe)OcapHlUclusion((ontyp1spiBqcPplishhyinϾϽz؜wϹϹϹϹϹϹϿϹϺϹθIfɕn'tPhatyotherishes,'llteasteself,"aid P oneayorsterPforfralxshaHneiFdždždždždždždždždžLJdžnanyodylse;$andn hole<ame~sconclusion.xixruthyoutepveniethingX''havee*familyasoHtudyeffect spirc1H3particular.It*:agreeabXMrs.rpa0uhXsw襡ooooooooooonwhendsickadache,iرgirlsere ertaincomydrawroomlow. /gaso8sess8okittYi)halways??airfnd(edisposal,Ycap tot߾߽emergency.ԚmAlovjj atжireillouttalkeSpshon2oc;R¸'">advantageA)salaEmma,ensayadesocietaw??eno>grfi9ozxordinaeAllaid,??@dworinst:unquesbxprecedyou77>pPmenІ8rchzperfumtwirlаkl`ock׼߽߼>keiefsdeclarIornew  i߼ǼǼǼǼǼǼǼǼǼize="3"acHBookmanldtyle">theostvercoming, geniusndifissmma,r"brightyes sis--3?''''''''''GYuietittl@lue-0dady,n@r؁iH''''''''''G7f0self--t(miabI'mld.ϼϺ׺Now,һ(8qMissannyNMH/K.feopse`visha軸esooooooo׺ooonalo@YgrIst8tnati`villagXyvewwwwwwwǺwwwvlearnJqtueougo`stnough.׹׹׹׹׹׹׿׹׺׮7//////////O//-ButlQ@draw1roomanmbuzzvoicsurroundedGGGGGGGGGGggGFbyEqwQalwaysthseca(chrpropeb@aid,ܪцdizzЍIple(unre;''''''''''G''">fss wbsomes0,jconclu0anldtyle">sayothingtll;evertheless,headeoodseferyeand everynehoakesheourfbcontinentsxpectedringome asHtte cHse;orre)seldom@yougleA)knowsphquficationsn@l,c@resistemptj@''showwhatЅdo.ccordlydiscussIragedies,ndviews,ancimodern tomsithissmma;2Isabella??rech(raexhibiown;pormochoicrchAmplimtveryurnB,`rtWflʋm0f,erhapsply,wHplayiribl@ynnxquQR 9fairasins.wwwwwwwwwwwvϷϷϷϷϷϷϷϷϷϸϷNowlذwhi0Fymnpoint,Mr.eorgggggggggggggSomerthoughceh2fؽ,0afɈ8,|Ͼ___________subsxtumretybouXim,aȀcfee(galooooooooooonopinioh3)acons`encjwhtiGGGGGGGGGGggGFefPxhgYIlongAodbodXalk;//////////OO/pjmooa@nHoll ae arleav7777777777WW76gayyerawroomeves.ϧ˸rentpa⿀ectrٍѹEishet/'''''''''GG''"R,y,aidb݁youre y XrѥfavPЅxrmu.3OOOO"> <ȃ13Q________Z"O,resumeyomysotuchissed,aidanny,ithmile.?????__???????9You`stavepoorpinionfuraste,heng`Mr.omersWWWWWwwWWWWWWWϛϚWRC, replieΗyforgetxare_____עסtalkingo;tallecessaryYto:limeme;XbodyGGGGGggGFeveroes--somaeelPHvXth(trouboooooooooooDzDzDzDzDzdzDzǮoiN: Hحk;0ahow?WWWWWWwWWBecause'm9sort|pssQth8oo;Andw1*ouneqbi@rd*GGGGGGGGGGGGG'۽ij//// WhlikeistIsabella,ЀEmma.ٽun`sta(Im᜽߾߽littlefnywasiasPH,`nkn8to߾߽maemmusyou]Gquiteȳd7777SheyallHkxdfeel;{lwaysuzzlbyQnt> anyhinglse."''___________^AccordXly,boutalf hourfterwards,ouIveeenHeߏߏߏߏߏߏߏߏߏߐߏmuchdmiredr.omersnceoreransforminto ousineorge,____________ndhdanengagڍHvery)eresttte--9toldלללללללללםלtimesrs.עס/ Nowlaykipcros tnfrom9svenpʜl𧧬ǭǬtJsame arjusset:sun 11atts''''''''''GG'&wernindqIwillɝ|sibacklxle驿">sha2with`ة8ggl!r ofuminarheruchildish'''''''''GG'& sohtگssfsddeWWWWWWWWWwwWWperplexity;y,ear(wnotstaken, 񽐰geni'oooooooooooblus97"Wh(Cous,˪`yladH{whPdoean?3GGGGGGGGGggGGI0ouIpokelainlyn,creplied*t1timhaveadItC6toreOOOOOOOOOooOOla`outrA?i ribHseriOggggggggaCalibri">"Indeed,ow,on'tengry,aidhe,seurnedwayithexed Imtonish6noainoIsab0a߾ǿ7ǾǾǾǾǾǾǾǿǾǫ߼7777777777W77;Tw2rmerV!en?deorgeager gggggggggggflyife othreye0sPR x.wwwwwwwwwwwwwwwwwwwwwwwwws,,deedHurnwayad;@uadd0׾׽quickp'xlosecredigooe.`wseriousIwdo. 9span> htnougheftshopXtooplaGeorgeomwithllisGGGGGGGGGfaultnotr.'sputatio`ablishment.{?_______________t IveryPemof㞐se,#aidbut_________itbeuchreekpo mammaWWwwwwwwwwwwwwϺϺ϶w;Iar(ayorqnendthoweb)racme//////////OO/.Yiv"a ntrieshگ8ely deyyache,ﵠlo9sȞxXthgn0asspuwaterr''mn.cameown(`fiamsinIp''sisxnjus褡wHzadmire@rEuroptI@sXa(.١o`ipdhahǼǼǼǼǼǼǼǼǽǼaimYt,erfectly;knpnoircqproduce轨׾׾׾׾׾׾׾׾׿׾>specns; aar umphaHaf0њ ;o___________trarreaturaleelirunnroughiheIrappxceptith@fh,, 0ulsixcharac.㺷׻׺ face="Calibri">"Likee,oureoingoay,#Xidanny,augh. Well,'ll unconsciousyes,ndat,impledheeksfheittlene. __________Itahvidethateir$madseenabykezNJNJNJNJNJNJNJNJNJNjbeforWWWWWWWWWWww?ϔϙ"Buteally,ary,aidyoung , isn'reeollars hy虐???????????_?wu[prulyCnothing,ptak`weonnetiiϥϥϥϥϥϥϥϥϦoneadhe up.ԫl(e4wouOOOOOOOOOooaQPwordwn3ٗs--availlash's߲߲߲߲߲߲߲߲߲߳utter;® yl ظshop,stoPhichOOOOOOOOOOooRmoxdel98a|rgainAh= ɮachiHshIlȿ.Ada``IHsassaarriagetoalooneourϹ׺׹principalcktpts,saw`you mechanicork`@wheelrAPdyaooodesidim 1e,rappXsnugly,ohXcloasp>dark-eyxgirlbearldplayYbareatxhaggypg.,;(fromhxurnadmih0whomionmucPs77toKSeexIaveotre!G'''''''"3"ace="Calibri"> thingandullsnose,ikelltherhildren;jwhatas0recise Ytoayorpmself?Ά`;P eyodylse;??"aXttlehlead.#ǒǒǒǒǒǒǒǒǒǓǒƗ??ThardeneheartfeorldlyJXunlock(byguileone7מםQsimpyarfsobueepaystPim؁ ??????????__?ojboyj1crptrickscHousx`ichvedǪǪǪǪǪǪǪǪǪǫǪǣk.___________׳Goɭajailkpenitentiary{fieretmost''''''''''GG'&senrutapA. n hyourhfa on.ua////////OO//`,)omerATh(soft/////////OO/.delicate;Ȍ@roughoic0yendЪlisp; dyfowe''layedsr;radlamengolyrGGGGGGGGGggGGa:Йqz0Xmio9o''question(GosJesusbeseawit(IHen//Bu*sndedt@ier8gobliPineam(impressHupon77/سall ovьIfore!So,Xehi0dcoZlX;77@-b0evN,neerscepticrbeautifulgfont>

modest,hehamelessndb0oned;zthis whatrwor8doesWtXnow,a`w8tQfaicunlocks\GoAwranglolemicsrreedhm*ology,"drawoyosomRone,ndeadnhatlear,rustingyee lessonfternalife.enlyoPyodsZchiihealldon9edhaltouHindeed, "whenttlelGGGGGGGGGGggGGy.??wwwww7mbp:pagebk/>HOWOAKERIENDSITHMMON.ǞǞǞǞǞǞǞǞǞǟnj?wwwwwwwwwwwwtIt8four'clockcefocau8wina@yMr.ȏ7s `hpcoun"room.Ԇsuشpn(XgwnJ)tptal1wila thJX(st,xskytores?XsPckytreet$quarQ8Bo0n@ardenough ugglthr!3heserpmϺϺϺϺϺϺϺϺϺϻόo i"entri࠘auch-thumbmemorum,hichh(inqhϼϼϼϹ׹׽׹׾////׸׸׸׾/////OO/.Amthboyhial xixpsiosignificangggggggggggggdelcyconstitutZoo 3achan@wpGGGGGGGGGGgGGorrow0hsXdby,Atwatc(mos߻ߺ"Ah,myҀaidr.tashutpҨ/y. YI'veotplynow;mpoJgetfulbo(seGGGGGG0">things;ome,ow,et'so.owst?aven'touroughtheasket?" bookndransferre`hemoallethicheutnhisocket, "now noomeozenpwidow@hon teaQgaXclex=gggggggggggf(ngswHwQɨ.hخ mostxtraordinarPalefinsickngerPкlaP-of--`ppmslp,vebodyn,(v׺׺׺׺׺׺׺׺׺׻׺nouespoڌ"pl8uney PXenoughк0irpejinx.o''___________^Besxi M.'sinsm(qPت0ard,(urthGGGGGGGGGGggGGBortiethemoveerNwriQPmett07GGG="13"> pleasingtems,enerally(ainedhentelliceatewundred<1dollarsereustnxceedPnecessaryoavemromtter//ruin,n:ynofobodylsxoh؆hlorx.777777WW76ASnr..aspIhisXroinubscriptionoveryGGGGםםםםםמםcharitableocietpAmade YmagA;adhiin//////OO/.buil ȣrchurche(ithhCiles;cconRgfou777ǪǪǪǪǪǫǪǜfious񤽣allege@ff8ohnfxraiseϪϪϪϱ_______^t04asomenevolepurposew饱PWWWWAbackout,u0paibalahimself;snooabз~noinnocf`ikeepways;9H'gggggggggggquantiБractXPgoods,itt big,chr___________^grown-hpeoplwhichPrbdiffusHkip)showe7ǾǾǾǾǾǾǾǾǿǾǑǟ8rҭmoved.׾׽Sore8monoiaZ6rithu ϽϽϽϽϽϽϽϽϽϾϽconfiitstreeXXBoston,ircPrelatoϽϽϽϽϽϽϽϽϽϾϽϖ(9enitStatAmerica.r..BfupYН'Ͻffai@India,urmah,hinxiоsddut-of-h-𽏽plxü sensibѣtkwithytsunless~makomney)re; andoney,tsoeonfessed,r.. didn'takehere,8ough8peHabundance.orettingprinaprisneylon慠Chines(yp box0oflotgPdhatot''''''''''GG'&3sa0ӓPwichslsschooloksYGreekߔߓall erXnЌȌHtsortMasi@arel.o''''''''''GG'&wondPhrbrmerchantsmetimthmʔ(aϡϠboAsi,heartXfuᅈmatter(raQ//////////OO/wpalkXaXm߭ieHavorawBHtfellowship`oextٙܓ}ofϴϳ''SoYcamosp9Hdw0thrivbuȾ~, zsa828rxyeadbaregggggggggggfcoahseam`ewou rimmelwhite;hWWWWWWWWWwwWWwneseveEplainhoubjec1(newOOOOOOOOOOooONbefQ񌺶kic2afd`ew,X 7777777777WW7_onfh`yaalwaysebhowhQusevotϾ?? selvi`0stsæhasuchccasiono?77ثnyr .eople緀soo`4鿸nty??????????__?>bexcommP"caryhBenetoH" ߾߾߾߾߾߾߾߾߾߿ߴakeysuRriHup\evil®good,2sendriǻǺ_jus8uny;ameoasshateoplokem, a!eyounshinendrain,uitsattersfourse,ottkinguchbouthen[c,particularlypPocold//didime.??wwwwwwwwwwwvBpMr..ever`redorRe>givegratitude;؋1OnksxoahispublishpiBpQonesixd:niftypousoso:so;rgbecaus/////////OO//itHhim,"wXllnowk`(8uinmedicsدoralȶrw2ranPstrouȶ_uTȌ`gJhearHteportJr bepO@ofooooooooooondistuCaurieexpresszpinio"Ǿǽbl˧BYreceIbybeli0wwwwwwwwwwwwit--YdysaH®* sincan'skXp *awayLL.ǽǽǽǽǽǽǽǽǽǾǽA,0sothr Q, AarelatAo0debts%p8߾߽azPtimes0,{yhaul8 subject'gggggggggggg">ep seecؤ+trPbyJoМur)cha!calaselfwn!a (pter tworomNew~TemeZahymnȰ(1ood,roly~ldtyle">letterfdmonitionndounsel,ithankoteonforcet;i 3yrewar(eHX𧸯heaven,GGGGGGGGGGggGbeyoerebHasurHfdeed;bundayccasItߺߺߺߺߺߺߺߺ߻ߺs howvorsPgot8;¨:rerzغߺߺߺߺߺߺߺߺߺ߻ߺޑɟ8ow9pathbenevoc8oPgxpJeyeal"qOnBmortalirthvchPitfelt,w//miPlfarlpIlifspotless--''crustApqlas`1aA77frexenHgift.GGGGGGGGGggGFBhilHurrib8yhФ`enwwwwwwwwwwwvparloje@thts, riYslaaXᗀl_n,iey`oppHbeegrocerylargPross-hlewwwwwwwwwwwbaskw1irbouZthenilledithundryackagesfea, sugar,andles,oap0tarch, arioutheratters;arrel~flouraXrder@toeeafimndray.r..extoppat77Iyoods rebou(0pairblanketwhichXoadeddown `yhhozhappynoh@n,urning77graduallyromm1frequ`streڇtw؛X8lost viewn e dimme@0ey3city.___________^׫תTheerfulzhisrloareɱ"longOOOOOOOOOOooOOwetlk, sittqbyطyfPomfortabincasin߸߷liPrs. Yaal# X(Xj؆ea7777777777WW7'roup1childrenaitudy0`sons߽߽߽߽߽߽߽߽߾߽߻"Papa,[ai엠lԁ+whatoesvean?t'sImyӌ8ay//////////OO/chool<. 'Makooulvfriendvmammof߻߻߻߻߻߻߻߻߻߼߻un2eousnpwhyailyyceive>el(habitati'K'''''''ϻ''GG''/)YpouЕhaask@Iea0AϺButz@didn'tnowxac)t.entmlhOOOOOOOOOOOOONweekseefoufi@outϾ qphag8to0XithJpracÔlxsГ`it;byפפפץ׆iؙ@h8donfouXPgudi stsleepi chai_____________ׯ"Mo1,kaiО0t#iXplaysɌ`rd(ean'tyieyeWWWWWW϶9vbs.ɬQ}axbed.3oooooooooooooooooIُQ, xM@Henry,rupairg">injur(innocencAwhich簀leAeralHtHnmpukind׻׿׿׿׿׿׿׿׿׿׿׿׿קקTh 1ell `now0oeaPJIXvee׿׿׿׿׿׿׿׿׿׿׿׿הdto???????????_??/resou@it/(|h8lesslب~ish'dusXǾǾǾǾǾǾǾǾǾǿǾƷshortrdH)g''''''''''G''g߻g;O, ahorrselfr..,xpush@ybhwards7777777776theoy,ortasoeonfessedhat @perceivthisoment beghpspey)ittlp:wreal`shآnkeeWwwwvmY,uppos٪wert 8mpetIdecidepit. "'Makǩ߰777ylvesriendf*mammunraexn,'says:OOOOOOOOOǶǶǶƋC'9nepy`owmɷymxwithYit?_~RC@elast:abitats:angY oooooooooooex.8wonderЛ)s.ĨScotso؎JgoodOOOOOOOOOOooONremarkbou--b@yhHI'motxactP2.Iust_P!ȭ)unul`f pcritical?????????????>intigquarter.ǺǹWell,houwa);dlayhea eack">!rocHghair,BeyixflickerblazetϾϽcoavi j"ehramp+eit؍|lhgarr`ϾϽ>hbeenϓPpowoIale,iscouragegggggggggggIoomYciwarmAPforthble8emselight="0">together.eelt,oo,ittlendefinitereepinghill ndome lastreaاprayXwa/??"Bookmanldtyle"> X.aigodlikembeauty,uchs ڍw,hsedǺǺǺǺǺǺǿǺǻǺrou i blsank@elcome.7777777o77WW7o/ Tspoxno(in sArthyXreڹ߹߹߹߹߹߹߿W߹ߺdtyle">whencetamehat(eynewim;ndsoonAnquiryormed !housfod+noerem.SA we c8roices,??a8neglectchildrenredee;lsankوόVKanZ_Yloshelplessirl:PǨǨǨǨǨǨǨǨǨǩǡh,body0IdH8ey(pass`htill___________^.٧(builtPfugeuchwre8s eXyikerfesuscre/ߢ'ϼϼϼϼϼϼϼϼϼϽϼϚ/Jalerktoѕ]citynocgϽϼbu)betrayi`tempterQ@goyL:}'s`wDgamingabl atratasyrobb>drawYampustlyHؽoff;Xtb0ithﺩwaI`Rham#thrARthisayl//Zsl--do)onɻuctiblockaffamyvu@psy.a_ϻϻϻϻϻϻϻϻϼϻϙpen lloso`rgeȼransom,g>thbbuء1stimulat1s㯛redeepOOOOOOOOOOooONl0hri80rQHchildrenporhrist--theyre allreitheolessouhisay,ndpeirhilonarthꆟ?!'srowingه_ou." ;ApI,saiano@r,\wasnbeliever.nYridefyntellect,ɎouɔGGGGGGGGGGggGFcoudemonstratHabsurdity93ian(? ꚯϛϚnswerrgumexfromiraczprophecy;utyratih,//self-denylifPI3H.hIwQpendًti 0Pifts2׭׭׭׭׭׭׭׭׭׮׭fow-,disraged⟁g(itudecpraisxoooooooooooפ, 'Tsome0inat @ؔ,'atϺϺϺϺϺϺϺϺϺϻϴ7,brkػAD~׽׽׽׽׽׽׽׽׽׾׽֏쾨@aؼHo{gacoeioYpIWWWWWWWWWWwWWz) no0h haXrawn avenwarҿso''''''''''GG'hiyriadZospXpr,be(scattseedsOOOOOOOOOOooONhgooV" oBlmostsciouslnowĽwwwwwwwwwwwvIy:piupXaiPIehimmal`autyAooooooooooongloryeemimxbe1طnumbǽ߽locclaXyPrng-expectouli.ȸpxrtϾϽull4៸caX@@angelQ( țHOӽdnpx-said, 3TthyveH,xworthy, Jesus.fhee,ndooroughr ll`ingAmen."LJdž !sithhorusf 0yatersmy under錁owwwwwwwwwwwvsweptnwardcdiedrfnim`emohYdistantߗߗߗߗߗߗߗߗߗߘ߆otars-ewoke._WWWWVSmbp:pagebreak/>ACENENERUSALEMWOOOOOOOOOooOOǮǭItsowlyXon,busiestoHtlhouay߸yettreetZAHoCiseemesertȹqsilex grav>T8artishHleft荨bench[merch€le;ϾϾϾϾϾϾϾϾϾϿϾthrx returnwerAwhichgxtational@ivHwwwwwwwϺwwwvbroupromvery캹Pt IhenorϺlapweekarryQlif Y@T+,suddenlyoXapped.ȓh Psolitafootfs,keWwwwvpatterrainropsfhower`wakchoe&wǽǼٌ2somone`wo!l`s setopithϿϾgnxiعzagsfeucernbxpfargggggggǺgggftancw_ϼϼϼϼϼϼϼϼϽanldtyle">Alone,rlmost8theewemainingriestsoveike arches--a'ebo nyster;rillrm--7nowHusheo-p.hief crib??Ndoct0jHh`outprosᓐim;m>(s, rromexc95crowbusiin//////////OO/alm:sacrduti`qupȇris1''''''''''GG'&pthirwnoulp"Wha ٨Pew¾Cst?SOOOOOOOOOOoOOMBpas8(n}itysw!aurgitidif`7ǼǼǼǼǼǼǼǼǽǼ>moeets3yQЗȫnasHheظaha)wpopul1jJuph!oiswrful, puH7777777777777ob,⽐8Srryo Xm bjecooooooooooooonitoncealsview.aranMedElamPdweller'''''''''''''&Mesopot(aEgypsngqHR,re@Arab3J/////////////">Proselyt vokndahroxingitateconcoursen!nother;PmenveryR,){tongue andnguishaveomeponimsirlwind,hisastarsoneoinHearkness,desuX0ertedy a Go؆ndsr//al.A?o;orndaun cruelob,earl`strengthfwwwwwwwwwwwvmortal,Xlp,etismayew9ᖨamongwpneoy؍ernoine#priest9toosa>wintru8d{spotsacrifice.ӣ٢horx//fing( api,ejec+avowir,ǷǶac@pldreador蓨prophecyicsweptownJfar??gehourw׿׿׿׿׿׿׿׿׿׿׿׿׿Stret鿠Jdarkce"oeelikbetween8ٿ׿׿׿׿׿׿׿׿׿׿׿׿׿עdeepen(everyt" طyNusggggggggggghroutbackgroذr`atQ`stormgggggggggggfcloudhrs.Լsampaptbsorbcalmensity+ooooooooooonb(T⯘hnlatgazupwarXo9___________GoshAi:fervor,onim.׆qeridWWWWWWWWWWwwWVmobcoartaun ibrutalxuse?f!all؁pJelOOOOOOOOOooOOn.әinks ,Pdp;whobe߽?`ontXinheilloufferyndthimс1last.ρr hearts9re thate(for;!pressndoomedcircle,own amidJscornfous(s.ԇmayouee//pedyupraiseyesqaagdalen,pXsteadywwwwwwwwwwwvolveJoh|weepingomxywnhoPwaillat''> butonxso, 0midicalis+s(is.ߦߥ77A`HweaznsHwu`m,rroundx(Qhowrangnpst!ȀАi`ossib`Lu ??i3lis 0aallplikcbp#suchwwwwwwwwwwwweaven-wH?ANYstR,oftipotl,𽏽edpatience!ͯalqXhbrutdierٍupidlrtorddoriInؽu8׾׽inxsatod.scow riesiinfuriwwwwwwwwwwwvPharips1soshiftig¾abX,wwwwwwwwwwwwhoutcurwiknowwhy.oiSgloryinb׾׾׾׾׾׾׾׾׾׿ק;eowpieyefilexstphim9vulgar׺mHA`yified!׺!lIinggggggg׺gggfeyesdmourlau r`|xem8mystousggggggggggacred@sXv)h2,)s0inromں exclamation, "Surelyhis theonfod.#an'soice)breangn߆߆߆߆߆߆߆߆߇߆vulgaraupandeer:,Heavedrs;imselfanno}׍׍׍׍׍׍׍׍׎׍trustin;et)eliverbiwillp) A`'s,wwwwwwwwwwvalso,lear,weet,npthly,ierceatormyobXay FXerǛ777777777WW77forgam;ynow 9wido/''__________^Buherawveilrexence.touroct6߫߫߫߫߫߫߫߫߬߫sufus0PsepIqIbehold.߲߱߱߱߱߱߱߱߱ߐ߯_777777777W775Littlou؀Aseepome衬rickeniscipleõhq-bro1m,`sPuda@cross--emblem)??????????__?>ofepesnfamy--u@blazeqeye XaXnationsymbol߼߻riumphhopglerY gXeousne roiddregalbanner`associathwiȌIBdpowerfun.Ԫggggggggggg>RoensigѺwavmn fЕ)ly''''''''''GG'&,aȦ lQfon;oxels___________f h Xself෸*ystical,ongspeakbgggggggggggguisde ibut e@n(glorhono`ϿϾimmort0ty.//pologiansУXdlessdispuJhiloso8zXgret oftonement.heibleellsnlyhat(isragicvhahegggggggggggess0ialoiithouPhichuralvationou(nXraveeengnjnjnjnjnjnjnjnjǍnjsecured.† ereaaecPitryooxay.׍Yatד777777777WW76dreadiYe؆ineπ musYusuffer,r bGǚǙlost,onoweth?/ToquesanswaousandoihhXa8a٤ߩ?????????__?olu,rgedqu`confidence--eotsrams_߰߯certaiacPsZtxpl@s--yepye,77perhap unsso8eep-ingulWe,ioalwaysgiveA ïydefiniY0r nlpsǼǼǼǼǼǼǼǼǽǼb image8CHellirlbeauifey)harsh0ndfetaphysicanalXn(rblcXg//@unlettdu hearJasoftehgazImournful??'myspiP.hrH @l@Шif@,zpassoHrϾϾϾϾϾϾϾϾϾϿϠthri;qimselfbloldY3躏Ǻemmup,y"Imyloodhpfy,R1remionǻǺ8sX.K̹غxsx weill,sZcrosϺߺߺߺߺߺߺߺߺ߻ߺ>entwith XlaQ simpXlhasߺߺߺߺߺߺߺߺߺ߻߆roduceR٧sur@unaccounta@.Ɂg7׺׺׺׺׺ size="3"acHCalibri">andlime,ithveryarietyfabit,houghHfeeling,rome whampgospelegPfor ٓsoi8ooooooodapPnȬ8riori, youhaveai !ϳϳϳϳϳϳϺWWWWwW_-to[ivz|pPcwork?????????__?>mileyomittpaHtoryqhow`󻈺IlOOOOOOOOooOOwithrblood;u ǟlHh[knD/////////OO/.!crucified.ș$Xqa`umbl ck w77Jewbsurd;eʧ㺈qsositiе__________^course.rue,rrnwho kqn0@ mostOOOOOOOǺOOooONcRculadiffnctlye777777777WW77>settpurplunic,w3make {at ,OOOOOOOOOooONonxaisputePoaJes)qdeadadmaffirmz~b0e;zperchaomeia3pr()iv(chǻǺdinnЋ(JshMarsill,8yaȎosٓҺpan> mattereryummarily,ndassednoriticismsSami@wineYۆrbleases.etnpitefrisbelief,istoChristas77outlivHmagationPHhou sreshhuheartsiftereupublished.Ԍ"oHJesushich////////OO//>deadwhomaulffirmo0!,kQnominalbteast__ߠߠߠߠߠߠߠߡߓbjectrpgioٚyocultivatxpor8zߠߧ_________^globe;ڦsc roughrex& ihbWW׭׭׭׭׭׭׭׮׭samwacYingme, r0thɡsehol׭״WWWWWWWWwwWWsoundsؒie blooѓ`sweete𧺆aff|77׻׺/)ity.Im0adyȚnlyb,ulsoeoqegLord{hhav!0cho9ybosomw7typhhverysincen;woul@ne,i9o77less.ìiderChri8 ( xth(etictory,--cmionegtrtyrߺ׺׺׺׺׺׺׺׺׻׺מruth,sealii@--s1pllyǻǺunacctable.Ͽr3prenlyPir׻׺abInɒodlike0(0;zҠǻ//remembeȲm?ׅ ovhTomYany_eiv7777777777WW76pe ЄfAn0l?ePhΚxk ʏA.nldtyle"> Nay,tsecausehhstory0rikesomovehu)bosomsninidualoncern.rillingoicepeaksr{cenefhguish77n:ԍ)thyavior.inathoY.teppropriativeords,ь0andH,hichakȔVdifferexbanyr]w8for톨 thou8___________shpiercedLpfGreenler,Jkl\lidFclaHott@ot; no?8(enXu soow,@lost 8lt0de@irattruth, )ece@d,no77ohadowredeem,grat0dis(hrall.îpsoree8pйzeaieearhxmwhoreim;regradqhopelesspollueoooooooߺooonnaturХ{rong`oKlivIreactionѻhbeliefoooooooǺooon0llyvd`enwitht.u)awR,ߺxIual mгCldaJesus'sش𦬔Z׻׺an .eo2Washt@orocswHoward.wkJtouchs(o *o`ofgggggggߺgggfa9?׹q@0@neelonapectrٺOOOOOOOOOooONuniXudgP(matЬshfromiPɭggggggǺggggg">Bible.󴐌pinavҭdeatoooooooϺooodtyle">hesound,oulnddy,ohDelivererhoughtaynPny pȁ3`gXcome. But@GGGGGGGGGGggGFwhonows h i(soesat@m to׫׫׫׫׫׫׫׫׫׬׫biرaffianceu鲹sPdis8ubpeiredepdoll___________ohatXdheshmoHfectledgeTgtbjicHplisheden˳,apt,spirfeelgooooooooooop",--''׻׻׻׻׻׻׻׻׻׻׼׻ה.Y cRmber 0e!''''''''''GG'充YeaXrombtableAmy oryooooooooooI'(wipXwayriviapdPcords,ooooooowoooAa蹨b蹐form\suastϿϿϿϿϿϿϿϿϿϿϿϿϬwoT9youthobservationpiedre_____________thypmdme(alsh1live#Withi㒙volumbrainϾϾϾϾϾϾϾϾϿϾϤǾUnmixwXaHatter.pan> THELDEETINGOUSE.__בא/ SKETCHROM NOTEOOKFNBGENTLEMAN'ךךךךךךךכךךךן////////OO///Neverhorgetheignityndensefmportancehichwelled//myiwhenwasirstronoud變ehghoo1meeting.hat77ntfulundayupongehay,Rqok @Sabbat(uiǷ?? w0ow asceiny⍋l`attctuy//ohere,uXHl !n#.i`wycomplncy@dɿviewselfCetedressed!ȍ0uHorows!yowgil(uttonncoat!xgoodoQ,rma(?''fuAstwitchupuY,jakeartk׽׼nɭ@p &clea@starte@llarurn!moPgQld`curlsst>*rg mom8,a8,gggggggǺgggfcautionookQIIs!ɺ@ruth,oseOOOOOOOOOooOays :hsomegreis@r񼐵icXoǺ~pҼnлJ+xPpepappeafromht="0">whichtoueverenferred.ŀyodyheouseuccessively enclosures,reeryifferentffairsromhosereat,ncouth lyriangulareaves.oetas indisputableepresentHonPhowsineuo,fheyou@onbetraPd''rensteafurlndcrambyЀtwisڇmselPoallortsloveshherea8huseided7gquewbox@upjoutardurmoudak8ybalur8rwhichɅppos0xproforzspecial77ccommodJIusgie| "(pholf8t`tӡraweaz؇Oremarkabilia scene.ɮelyǴǴǴǴǴǴǴǴǴǵǴƹe\JnoticP i9ezcong"doors`so0nvyhatereppedown_`p--a9ucRhmonlߺߺߺߺߺߺߺߺߺ߻ߺunlucky sulpaatrangH@membpZwhen𺧺ǻǺgdFrench,QireunsuspiciPdړawaiYhim,ǺǺǺǺǺǺǺǺǺǻǺmadey0byitchadevphisȍmiddlgϺϺϺϺϺϺϺϺϺϻϺ">broaisleQxit0okeuгmydmor'sennelǺǺǺǺǺǺǺǺǺǻǺdžXrisiboyhlikBposurxSuXexhibiYsoGGGGGGGGGggGGfortunat`,+verarbutillfound(emusi77wa|iYvedark9invar2peop wwwwwwwwww/XupBssrRmAankPv ageк(ct(ooooooo׿"Calibri">theuriositiesfveryeneration: (re,romearoB,yive beenhrownis,ndXppenedotYeiddle.herewasIsraeleters,ithoodleghichrampin(meeting,//undeviaegularity,minuteseforime;2Jedediah8ebbina8inQstful,oonsy-lَgentle0/777777777WW77whosou)arHif@gardpnee`qϡϠead#eyseemƠHybo+tape;7777777777WW76> Benap8hosh lygetqϭ">stӫeraX)lroughsermoexhibi)//////////OO/.talligurlo(ngle-bhdoatTbuttJasgXalatPр,lack,ornpectacltretchxdpoexm`ofhveryZ{vigosXwoooooooϺooooohmeanlbunchycarawayialxsripine`nd.oooooooߺooonT,Au8SXypimps9WimЮaleOOOOOOOǺOOooONbevylit0,ladie9smptra10nnets__________tleevRlbow3lklogtbigx)ooooooo׺ooonforindmill;hotitS\ammehwaH纏7QobbٺϒʠshowthHٿHaotǻǺϦetteriHwners'းntisp`!rustl[߻ߺWwaoprofounonommwousuddenhwakeǻǺOldtyle">them,ndet qoanninglisterwithedoubledevotion. theittingutnorn--)oneagon,rwo,seseme,ackledpith "ograys߈bay,܁uffaloǍǍǍǍǍǍǍǍǍǎǍskinveXseayyfushiQandll:family, ir//////////OO/.best,fHmeePhileastBosWatchzTowseߛߚstoodrepartoguarwe8klyro+hPl١??????????__?>downaear.rrivLeXrf10ablishmgener yonductyhemselvesgptecorum,yp''''''''''GG'Ygo9hsleep(`anodys,xceptenomxsHss-lovbluebPlaesaiHoumak orti??up,Rou +h(napLirawpyainly''ou lphaloffendeNow0betweȎϠWWWWWWWWWwwWWsixthlies,8vlᾒ썿3l/????????__??patriarcirhi9froIgh(pitsober(_?????????_??">aiPas8eexPrhwHۛHpropifterichWWWWWWWWWwwWV{ compose'g;#ertjsϺm2ayspSundp10odhristidogخesire.'''''''''''''&''BugloHoureeZhHtshngers'at--mpyrean77қwhoejoiced齲 inmysiHrtqfa-sol-la-h,pan> who,yistinguish8rndrivilege,ou"rais fallhe~Ccabcal otes,moveereneroughnchantedegionwwwwwwwwwvoflatsharpHthirdfifthoctaves.WW????????__?>ThIyatng erylineides Ȑhouse,trebl˕reno8basPeachithtspproateeaderndsuppor`srXwg0r@eeloomourgeople;//77parkg,`tluLirlns,{Xiribbonsryakaplwas#Ylivea??''''''''GG'&flo rdenfiforwnfH;mezo1.ɱGϾ׿׾spipbee ,|wearglancgggggggggggfnev!nretur8c|of`muaWWWWWWWWWWwwWWJtoirtati qdist10oetyMrwRadmit.exitioPvillagϺϺϺϺϺϺϺϺϻϺcoquettattrachalfPnyy or0syhts.׺׺׺׺׺׺׺׺׺׻׺ֿ/////////////.ButɊv eXtalJXsP ` iimnegleRto`1Magnuspollomwholirqredoubtabl'߾߾߾߾߾߾߾߾߿߾chorerhccupiyehonmidsldǾǾǾǾǾǾǾǾǿǾ>g :ex(lpposȆnpan>good ,feerelive,ouHnevereliHt;oroerson ،@ȅleft!ts[y`+hvisi@ihisǺǺǺǺǺǺǺǺǺǻǺformre ,Clongѧdd ٔen> eyes er,ithverytave;ndarticularlyhen erceivedy&fallingff imeriscrecynitch;whatedoublxvigor??wouthump0e !roar dequequtillmo8r'sondauhemkippd aminto77l0gain!oǣWWWWWWWWWwwWVO,tasiny9seeːship8eichȣ?ϩϩϩϩϩϩϩϩϪϩΪ@agybusss;x0pif, ot,rowsyunday,ǰWWWWWWWWWwwWVchoirubacksisleepipfirs#seXheWwerbliBoestselvȰHgoodarPrhrswwwwwwwwwwvfaAordxxgeros. 'Kiahono___________dvocatyou0ozdraw"Y`ѽomay(leisure,WWWWWWWWWWwwWVbetween|wakIsI;Hdeed,got ire utooooooooooonkrsDeacDQHȌtwoortl0lgggggggggggog`lem8below,oaduscw+بeads,h>upeyetak{compsalm,roloʺߺfinit1allnote(Tftt2m0cnn Hdreyubbhisl`ab8m;ѺFbsuHoffȮeady͆mhpenXupithГirreveriec`ness.wwwwwv"0"> away!vY@erZbuilditself bepulldowdGragscat`ed;eXti t8 ughmyhishengoh=heryitt1oyiratifibyCoHssiongggggggggggwhoptuliphpines,تhye xOOOOOOOOOOooONcovet3aboob J, caxex___________^b,deviso yhsur0lyserbGGGGGGGGGGggGFvicxsumHays.havsitedhepotherettood,ut modern,(ir-ling8ildIthaandsnHsoomearsorfit; Bvarious0miliarzsusioxeenside,t??oneema.erily,ustgrowoldasaeopleapoהדspploXriescheckyself,layownxn.ǙǙǙǙǙǙǙǙǙǚǙƞߜmbp:pagebreak/>THEEW-YEAR'SIFTO//ggggggggggg߮arkli snowovdillJvey--tre;bushеGGGGGGGGGGggGFglittwithiamohbroacohail fensh0߼߻lik)8soliil,e yfxhicis TedǼǻbetw eachWgWWWWWWWWWWwwWVInyardyerwel:Qscarler5mountaashGGGGGGGGGGggGGhine8roughrane@cas8crystal*absprucPϾϾϾϾϾϾϾϾϾϿϾΛtes,owhrost,avssumby77rXiancy. ephouse,ZdoornockApi`teysuck2:aoٱoastZumm) @pXshe`varn\respleir`npgs,nowheamؽIlArayexynset//t="0">Withinhatarge,ld-fashionedwellingightouee 0amplearlor, gabacklogʱesk,uppȾkeepord׾WWWWWWWWWwwWWcr!pi`dry,Ywhirr}-Qel8___________Aomtɽ`ncern,ccasyPr@htoJgggggggggggfI(oun8napchuthroughrWWWWWWWWWWwWW/(ispitab8emphs齣enjoyself(ndGGGGGGGGGGggGFhav"kInt)0hs drawpZmakievesooooooooooootPm////So콸@parlqhe@tPҁhXday'sidIxug77>mayit,utvenHsreehtG''''''''''G''CrofrienCoPelׯPxpOt>

passNY'saspinisHmily.fouhimtiBamewwϯϯϯϯϯϯϯϰϤaYkinheeryellowsdaysYpoug`imebtakHggggggggg 0erty댱h soJackrost«BAced`sprucePdoorpgivotgr fulbecomprinkPsiloWWWWWWWWWwwWW7777777777WW76"HIyou,yar ,i08shaP--kjust׻׻׻׻׻׻׻׻׻׼׻֩Է hamchicȅcoffeesmo.͈3??>addaerly-lPwowhow 0(KXeXJohn!be?????????__??pardon,r.uart.Aжpok8twoAvbobro_room,c0PiЙaugldog--)lhilaritywwwwwwwwwwwOHaba膈matiHafnoxpgloriousk couhav____________generated'wwwwwwwwwwwooooooooi">"Ha,omnded!--youoguescdon'taanyuppero-night, forwardV,pomn rymoHtonϾϽencouragementCc, !,Irep`з8various,߽߽߽߽߽߽߽߽߽߾߽byach0ildrrzomop7tak">recus arm1fxdeposiaonce="Calibri">hert8'snee.hePirmohofisoat,nd nurned solicited.υτ''"TellimIAllys,aioldesster,ithatronizihairGGGGGGGGGGGggGGBPapa'sew 'EarXpes_dyittleadytHstכך// Amamm,o!kmolmapplausesfߥߥߥߥߥߥߥߥߥߦߥadmigircle׫ת//Winthropedologetica9meA, WЧspoilwwwwwwwwwwwv--i(at--everynfsownRoȗhwhoetstieipprou0hiseckputonnonhea8hundϽϽϽϽϽϽϽϽϽϾϽkisim!degrewoudisconcertdog鍠world.OOOOOOOOOooOOǽIf eaut)oyr@anhisarration,se@@rhroughong iryalesHnd old-fash ediahostegendpurelyor ownmusementόόόόmuchepridalleayyamma,bfillichild'1adith7777777G7ggggfnonse.בבבבבבזט///////?/____^Itpow,owever,imurnrom"beaut`xsubstialעעעעre`tie@f icelly'sricks,theyhoupbecome(obstreperous.WWWWWWWWWWwwWVϋϊInoursefrnextayoundyself,llntentsnd''purposemuchart)Icelfamily1ifhaenornbramong!m.thatzinrialime,he''secrewerel"blackberriestxixNew٤ Xweekȟ@littleoard8res0ces=children,thHHofתתתתתתתתת׫ת֋enuityhskquiso(gettupsjforoooooooooooneaerxm.ԧboys*0ir XavhanК (`penn%yݾ7777777777WW76carefu --ӦVgo8y۠ipapabootXbyilwoodꥀdgn--mlxwihstunat777777o77WW77add@hi windf@hrom#XerguestfHnd.OOOOOOOOOooONAnow̭ outailo8ablenair[stoolpH?????????__?ountv`bwonder n8 s׿׿׿׿׿׿׿׿׿׿׿׿׽ǾǽMy ,oughieasyircumstanH)wold-fash@H׽>his蝒.eeow`childrsm8`excepuch׽׽׽׽׽׽׽׽׽׾פsI8@00yexerCown. "Let1mo`th,3husatoaketՆS77777773"ace="Calibri">generosityillhenaveom(ignificance--itseryasyor hs̙ocketstgely”haselikנWWWWWWtlemPsubstheytgettmammaewuff*צצצצצצ׬/////.papwrizdesk,siP9numerableѯsteraooooooodzdzdzdzdzƘ2Ally;☘afx yideexpedЮAo2boѳ/OOOOOowinqui`prip,bservJYctasg9lymodp.o0tilliei|eheX`a(@lwwwwwww׺wwwwearthȠ~moun o-sevcs;erXwasoooooooo׺oooembx rmicirclinclud I)a,Coul纯ϻϺfiitђheavXrmbrIg@iiyselfJZimm8w8im0aayidovpPǺǺǺǺǺǺǺǺǺǻǠxoٲsum0show !muchIPffߺߺߺߺߺߺߺߺߺ߻ߺޥgР, ئo ijwhiPYhlongoyqߺߺߺߺߺߺߺߺߺ߻ߚ?aҺm"ڀs1valu,⻘elpYtoϺϺϺϺϺϺϺϺϺϻϺhinkIcertasmallnnyZfourtiͺ׻׺pretoiaistermakiImarxsomNedҺspan> aeryant-lingugarorseorlly.issmmaadhesualӆyresourcefouPladies,lossIwted,ndnittscrochetneedlibusyerswasivprivate sonsailyoEliza,nableprqgetpomeap(HՕarksrГ??ll-importccasion.ntairrmypervadeb7ϡϠwhocircle.ɓintr`withHnyecretshatPcousca lyϧGGGGGGGGGggGFmakbst, YurnboutroomPHbe/Ǯǭhloro "remembers--nopoell̀lppapaowHiorGߵߴa1ׅ׵eysereobuǻ????????__??him0new@ksHBa Xackonthich¢irH'//////////O//">0shinlleviou s;`9ǻ a/////////OO//EaknittqQ.Ϡ؇Pside4ߺߺߺߺߺߺߺߺߺ߻߭8sqhrappxbrown)er,lsofϺϺϺϺϺϺϺϺϺϻϴ?A,prougme8advertencealwaa񧢮(public߻ߺeypTecclos8ounselsbedoor(XcornersuddenXk(offئpJparticular ;e8mi{ed.ϺϺϺϺϺϺϺϺϺϻϺΌlutanig@okrk4ske?????????__??aЌaped;cessaejaQtionadmirz?????????_??stoamrom8privileglؓYronmooooooooooke">noteentionedorheldythers. "Omma!eelly!xclaimedliza,artingorward;utooate, `3itber'`fix?+___________a8raluHhimselfrea0)inalprofouways輗ϼhahfdaptiXhisresentsoheastesfrreceiverithout excitinguspicion:orxample,poucomepn hisoPr'swwwwwwwwwwwvroom,llootednaYaid(own,lpurseߌߌߌߌߌߌߌߌߌߍߌgleefully8begin,--GGGGGGGGGGggGF"M,,hichoouike0st,ink 0blue?ۜǝǜThatepeonircumstancesyon.o/'gggggggggggg'Well,u8=neckbboЬ'e;pposemebodya'''''''''GG''go buyRg`Ƿ;Wh a\bmos8uitablemIWw߹߹߹߹߹߿''߹ߺ߹߰wWsh2ZyWP0a0g////ﵗbtܪ)g)tе'ﻷ׻ (goodP)yahow㥺getZrty-sevenents,ayϼǼTom.GGGGGGGGGggGǾǪ:hol8"There,ed,aysom,omingownhetairs, I'veoundutust Iouxnotishoaveeenequired,nath,giiny mamma1cadesshatxWWWU> <ȃ13Q________Z"Can't?sWWWWWwwWWWWWWWύWQNo,nd'atellou.ߎ׎׎׎ד//////O////////Now,lly,aidapa,retendingo왘ggrieved.םםםםמםםםםםםע/////O//םW,t'sobe--somefinorkϣǣǣǣǨ?wwwwwwwwʉareful/(Emma?//gggggg Yes,'`very;;|--weayty7put77a.ouhdutb1ityRby羷'׾7;Ihinkm faira@oxthe80r羿߿߾Tcon sationowigresseoubject)nursme׺ǻǺtake d;hoСȐkiچ۷QulnfϼϼϼϼϼϼϼϼϼϽϼ΋heartddpht`form. CPapaȇ:a_׾׽tispAthat ssoong--measuring D~littlerm////////////////////////////*A),B?hy,ouotoPgive ((ishH?7/////////////7p> "Iethat(ing,aidlly,peak؁0eordithreeffort,Allheustlefreparationeased--sentsereorgottenray aboutnfinished,sfone8wadᄰarto(irndan/////thing;hiupnitcribCelovedQ,ssІpdburnwith sseverXɎpoXrecogn`!''''&s`at(8er.ߘߘߘߘߘߘߞWߟwwwwv77777777ϣϣϣϣTdoctcamewicay,۝ vytepaBXch????nxiousXwtolainlyrHen;*28eachember????????װװװװ֛;ircu\,mplor۫himto/OOOONresavdarlbstideaddis)onGGGGGGGG߽߽߽߽i`rel coursspitba򤐀迠bneooooooooooo7777777777WW76"I8ouyselfrepdImeetod's@Hform遐WWWWWWWWWWwwWVcome,idinthropc; thisIaorgo.Ɇǻne(dxyq(hl@Aldie.ǼPvenbeeewear'pseembegggggggggggfprogrm9rapiYPnrUenSoctormeYsGGGGGGGGGGggGόch,hpuۅami8gahsurnfulknGGGGGGGGGGggGFar$cribǺǺǺǺǺǺǺǺǻǺǿsuppogf,hthnffortopeakalmly, "thahis mayerastiths.Å~׉׉׉׉׉׉׉׉׉׊׉Theoctoradeonswer,@d@eholeirc8ofrors sist`gggggggggggfk@utnbiteeping.ϖϕ7'Isupossibrs(livill-morrow,aiskGGGGGGGGGGGggGGT--birthday!_mB.Ol11\77oooooooooooomWearilyasseatches.ach}wradkiFpaPlheek,1bfarewellgonoirooms,~sobmselvȀl;faC\aldroubed.,awhideXirov''''''''GG''kpsaitfde!oRprذcomion 'sayerOOOOOOOwOOooONhourpresoluterefuexcludXfrom*sickambGGGGGGGGGGggGFStreS8ػ}rib,ȧddith8eyey䷉attendantyaIosadminbgedicine, ng illowbhead{ou0rialso?ǿǾlXxiousədeۍhif stoollOOOOOOOOOooOڒpass׿/////////////">Aboutnourastidnight,hehildeg toxange;eroanscame faintandHb,restlessvementseased,baeepheavyslsetdpoer.όϋ''Tparlwistfully Жdoctor. "Itsrl #,POaid;swillrobabswayfore[aybreak.cOOOOOOOOOOooOǡHi1grewa#eyefanxious''watcipalR;etye2gggggggggggfthing< gulaygx@moPuеǴǴǴǴǴǴǴǴǴǵǴdiffusetself rwhosur.hop/ wnܻOOOOOOOOOOooONmindsEXRho9dutsymptomP3,GGGGGGGGGGggG7Apossibwithod-,n sw٥[inquir77set,$itķ livewwwwwwwwwwrAnurIassedrosylowNYear'sn߼ǽǼ`blushWsnowyiteneslscapFoffrom_߼pcouXsee8lploriousnris/߼߼߼߼߼߼߼߼߼߽߼">aڻPrѶ`fodarki;hapveilhview;)''straglitؘamo easttstXchamber.ɋe@o{goldhairndalerowfhehild,ighting itpsf angeladmilednt;؀lowlylarglueyesunclosehgaz dreapyround.WWWWWWWWWWwwWV"Ally, 2aid*faXr,end(verhtremblwithexcitementǜǛYoueotoveew 'Ear'ses0whisperrittone,צצצצצצצצצקצfaintIϬϫ''Iliefromy(artat,r!doctowhotoodi P滠ersiulse; shpasp ghris#Ǿǽdiseasweaope.wwwwwwwwwwwWWWWWWWWWwWWUAphou@turnɧgladerty;orrelasticwwwwwwwwwwwvrapidityinfalif(QsignreYivigbegmultipXooooooooooonq 8߲(ly i;faarmsiswerWWWWWWWWWWWWWlanguxIeooverflowproofKendess!chiry׻׺membyshopCOﻗSe@children,Ϻ˖ent8ldؘurNYpres.hatȵH@qGod9?ǻ7ǿoooooi"0"> mbp:pagebreak/> colorithrofnowurden;ndgainewhs,springwi breapn0mSxdrawHlongDSkc77more,0threeundredimperhapinto8vernalrown`leaves.ɓHmesinkat rQqou`stȓifilynit,sHfilife'sxie8eco0@Pm.urak!aqpmeditationHremembrasust77hY0(grcenturyfteru.whilH8pakyē``eaIndians;riumopen77>ihtJangXshade>sQ`arbutufaxapaoce8shellYavqhfragPta[sfeetѺfjfcasts8`owHcheckerberد,ǻǺ'allsHwild,ameles`half-yg#i3ϺϺϺϺϺϺϺϺϺϻϺgloomA estSJdesecra whenrtoȴ`tificϺϺϺϺϺϺϺϺϺϻϺl)Paid:IstretЀnbotanicier.ӎ)ﻉ days!--lueayyowPmmerbob m:`r su8aoperasuchus(MozartimlyoooooooϺooored.“ hnmukiustgH;onderussIߺ~explomeasuKad)(n擨erYutZ0@a麟s--Andovzs8qbeg@pbettl'''''''''G@ face="Bookmanldtyle"> withrex Xnalrownyprp,noblergenerousWVthouhs,Б "le shi hall┠orhofWWWWWWWWWWwwnations.GGGGGGGGGGGGgGx6ce(ard,ry`!\AH,at߰ߴǯ0Aweedabundafoodueirhildren;jWWWWWWWWWWwhoAness Pendealeisu!oqsoftrHful,ǼǼǼǼǼǼǼǼǼǽǢhPghptyIbec.ike͇SyzX߽߼? porn(ApAwiwX؎H,btoϼϼϼϼϼϼϼϼϼϽϼusRfruipromislؼhPcherish`sao8oak,Hauti!itsgbrokstatuesAiquoǼǼǼǼǼǼǼǼǽǼwrexerprowBime,glorio suggLpasgϼϼϼϼϼϼϼϼϽϼaevetIinkllQmoQɩrecةacro8*ollowH// s8onRourligpapers.ԩiriterxp8i>sxwhmeeytupsubject, d؈@''''''''''GG''>won( glamcou(*fallennheindsfny9 descendant"Puritans,at!yhoucastettleoswwwwwwwwwwwwhonoredravwhereberoudokiraurels.όόόόόόόόόύόΑ''''''''''GG'&"Itsard,Hay@ forover]beautiful--notm,//////////OO/.bubelieinx`initylso--giv7 tothinkP8blm. YimAkeepƙfars'ay'''''''''GG'' ubscriBlymouthonumenٞlHirw@Ǭǫdid,i*emoratroyxrisingphok77(nkness;±wa1e-sidandarrow-etٍ𸧸ǹǸBl`(sawQ9Tr's)ly@ternpracticalғBlizyɯplf@ar'''''''''''''ood.Ԭ/lewtbecauswjWWWWWWWWWWWWWdislikXI, aBsePHSfoolish2lyxbQworldsk8yammonunryeous9otϻϺJR`rswaᴘraulliltgainsr Hٺ߻ߺi9aorthimundarManxi0piǺǺǺǺǺǺǺǺǺǻǺbituhiwnorn!(xalte I Ѯrߺߺߺߺߺߺߺߺߺ߻ߴOhH89odilemma,0ss)gogȕqϺϺϺϺϺϺϺϺϺϻϺϒ xlifY2yercenemiHQeafguPfriendZGodndan." ȩRnXourؤYsrshippa{ont> beautiful.f-mindednessndpotlihonorre hings,theyadose.hatorkftcompIwithoftyjheroic''life?stotttero(M s0ichaelngeloד__________^makhtatuxٍ yIPaaublim GϙϙϙϙϙϙϙϙϚϙΒYRap'srtoonA(patience, faZ/////////OO/.undylovMaryycross,oǟ¢8al exdonna/קצpaintȒld2n,u@speakrulyour(r?????????__??>xshaat,(vir sixedcetialO׳׳׳׳׳׳׳׳״׆hHla`*0eslA eem2m೿GGGGGGGGGggGFehly.W߾߾߾߾߾߾߾߾߿߾޼ϽϼS㛨cPinuerable)B pnermǼǼǼǼǼǼǼǼǼǽǼǏ1isi9Venu+8twardrYyanr`was߼߼߼߼߼߼߼߼߼߽߼ordfodsprithroughhomengHcc0xѺ@, One;uҢpI blnzeverorshipШanit?????????__??w//Tefith gre8motmustkBshr𘠳//>temp physich˪xhseeorawY'''''''w''GG'&upjwhichah@J'|t="0">Chrishaysfohnheapt, "Whateyeutoroee? OUROODOTNINTER.GGGGGGGGGGggG翟ont>

satistion.eetsisootownithardtamp; resOOOOOOOOOOooONrety.ooonshineankock!owindlingailroads!gό,ndl defaulter.lltrue,olid// oryemschoreoxlifxyt.oopfHth,akeohmiserwionRdeabefpartyeveryqng,icay2eossess`f2l.dis@§yghjatousЛ;t77Jsecur ;ut last"orproᚺhim׳WWWWWWWWWwwWWϸϷ_ L"T!ld!cri ENȖ;ann@AC--Hd!OOOOOOOOOOooOGGGGGGGGGGGgGGEInucerwcour yes8day,errrof؜8myselfhilwwwwwwwwwwwjogaloHin@ -fashchahinspecHewcrwood~lopAacquisitЍhadets`!grh`hnP, to0reflػ@sGGGGGGGGGGGGGFDofairHdy veideaarQ8n/////////////.firXFebruary?̕mssureXrcؤeasNat0wwwwwwwwwwwwwvneawantsornameqfull(r`lؤrt7׺׻׺ pan>Seeere,ornstance--letstophechaisPandoutinute blalderȟmXwithryl;Qch-hazeخYyellowsiQfr8itHedgyr)Hlikew0iěCir'''&glossyѲЬ` ePyemcro鯈gɆ:x`iceagsrpberri ߺߺߺߺߺߺߺߺߺ߻ߧummer'!r1DIady(pendantorgar(Qwidwa(joyfuTwئҮШ`etiwwwwwwwߺwwwreay,oupsee蘸-8js(AgurxngߺamoJtonxas sklyY`yid`July.Ćps! -codۥlw)newarkl(intojfairy_______Ϻ____rota himtHdymeltssuch(wwwwww׺wwwwgodsIoch$off X@yo:mZdgew/ﺏ0.t퀊bncbux eemourߺfAipp8ue nkpassed,ay, "FiIeait> andadam;iceimeshese; inprilou'llius`rI;q&flowerrekingpireryorex@eason2re'oeᆗ'''''''''GG'&splendidiXaya푨h Qwo."7ǒǒǒǒǒǒǒǒǓǒƐ??Thenzcloudsf wintskyav earuritylliancy'מםthatoSsrival. osynts,JshadGGGGGGGGGggGP`gold,Pssy,lmhccumulationuminatedapatOߪߪߪߪߪߪߪߪ߫ߪdrifHacPBJanuaHafternoonxbeautif exceeqwwwwwwwwwwhsummer.OOOOOOOOOooOǺNei´tree s@8per,estitutownecury.ɛt(rgeoutudmoatch*ofjabunda(fage,tp nkl8ȩbKPgrZful(ato3XXiXlacg߽">networkIbough8knotyeawig[budnext8'spromisefleec8ylolPam?r1daeeilyondmagnificeelms;0-droopyape'w`owa`Ahoutlin`weep*wwwwwwwwwwwǴ snows.c@ca`appl&why,Wy/////////////.lik onyump,cushionXomuazǻǺpossible;utnderheevealingightfintryharacistic twnderktXsisclosed.___________^׊׉OneJmorzenHis--howffliction,hichripssall??ornaments:accessories,’ngdow(operPsolidחזwood!ourature,lo suwide8fferennopleoeforeGGGGGGGGGGggGFseemedotinctgggggggggggߧߦBh!pony'seeXre0wpkecyath7777777777WW7ha貱itinH"Ylot.ԝIruna0ephollowKeihr贁Xe󝐜daJhelPwX7gggggggggggg`fragra؍.׍ofavtP y祰reasonseveiralsamice,zlong,peneedl꽧ǾǽleavԶbp+cptsibylZsXthat߾߽nr(mcheIn`mmsroضn)msϾϽpОaof`cnlytx"QastearЎ;9Ǿǽhe♨talj9Po8qcool0s bdweg0rpYy,avA,)winimeHimooth筷loor;2hyurtaishut :JvoicQҥ̻Jquiet. "You“coyy;''ynorHdPep;Irochi@nhra.iWOOOOLht="0">downndeuietromheold."tfeofselumberous X Tsmall, nd-leafedartridge@ryavitsimat,lay(ut//////דדדהדօ)scarlui0Ahere black`ith still????__?>green,oughSauishin0notnlikehatnvad0mortalsesǠǠǠǡnjn8cXea`r.Ȍoo x,arnHx7777WW76Indipf#y 2whiࡉChristmaǮǭgs:m0, dauntedvztoIhe7777WW76thisay, hafy!ۮm`rǻǺrejoiceaXIpeculiarlowWYnamxȮeceive mpxtific8d-fҔ0tsotanftknow;Qɺalwhemyi k8--pPպOOOOOOOǺOOooONendxmإlietwiNature'hildr)usdoticggggggggggfcircle.ǼǼǼǼǼǼǼǼǼǽǼT1 sȨly󏠜po aboutertaxmyAal߽߼am1Xobscurityseooribes,neXsh߼߼߼߼߼߼߼߼߼߽߶Oobrttܶlabsolut3ledge.żonO׼׼׼׼׼׼׼׼׽׼ר waHelf-discoeeas]*hx, muPfǒhadadPurpoprnt i )a߼߼߼߼߼߼߼߼߼߽="Bookmanldtyle">partfheoyoXinkeadoundomeg@atonelsenew, herouse,"aysheebrewoeandurirrees, isinter,ive< ׇ׆>shelouchmallame.ften,n2l-fennow,eetwwww''''''GG'&plittleootprs.heyavea,8lplesinnocenOooooooooappearancHstrackaosxt kchild's????f.otefm forgothFarkQeeəǙǙǙǠwwwwwwwvremembɆ!kindly.ǞǞǞǥwwwwwwwvϩϩϩϩϩϪϩAzwithotoesRfinger arm`uleafyasur0WWWWWWwwWVwelo;way✘ achaisAaong1inIrom////߶߶߶߶߶߷ߩ wolot--ikf@ncheeratielifew________>har`e*acowlp,endundexigo//h -droppX PignobuɯӌnhHo77every꟣twiZlowerSbrXlymi:keepsSGGGGGGGGGGggG_hpz z,rpt7777777777WW76shɻsunshiisshahreture//////////OO/.last's䓸talkivArКglorifie߿߾߿߾_______ǿǺ____WwWWmbp:pagebr/>POEMS翷 Oldtyle"> THEHARMER.߅߄7oooooooooooooő "Socrates.--'However,ounimmiasppearoe if___________wishedsifthisubjectoreoroughly,bbfraid,ike___________childrenXest,n eoul'separtu8frombodPwindHh8d___________blowtway.'רק/$*w/Wׁ׳׳׳׳׳׳׳׳׳״׳׸///////////O//ǪǪ;UpCebeࢺ'Endeavobteachsttf * OOOOOOOOOOOOOerhapsha pirinurreathatpsua??????????__??\ad.eteersuadeimoбdfath,׿׿׿׿׿׿׿׿׿׿׿׿׿׿׿ԾHhobgoblins___________G׼׻'Butouustarmzeveryay,'until׼׻haveuietedsear'?''whence,ϐ7'0McXwerocuakilful7777777777WW77߿Zer3as(nowaYbolPeO߻ߺGreecwidCebes,'eeplied: 'andnturelyherere Wlongs1rmate;ǿǿǿǿǿǿǿǿǿǿǿǿǿnj׿FaiІ frihshreturngOOOOOOOOOOOOOOVDark trust, wru0agony.??????????_???;WyXsife?ἐw1usdeath?Ǽǻhenceame0wh0eroe thosooooooooooo^o,nᜰmetrickenomside,7777777777WW777Passolofdow*repPǻ?????????__????t;A+ey d@Q)wecOOOOOOOOOooOOONOrglivxsnknownli?//////////Nce="Bookmanldtyle"> Āvp> 9 redy:0Pternalo3bSo keryouthAns,epround׻gaSocratl(calml`owoe7777777777WW777__sage,ropheticyhr//th'siroturihongh_____________TheyQimot,񮰝®1Hvine?????????__???>LoeekHander\tchlife8:--WWWWWWWWWWwwWWWReasoI,spi[forzlG777777777WW7776Dea(camqd`m--doubtasee/font>

PILGRIM'SONGNHEESERT.  vp> <ֆuLastf ly(ne,--unknownnd 0ly7777׍׌Oesert(`--passed8yhildhood's r.''ߐߐߐߗ_________ߙ"Theorhknewotend piousaiden////Ϟϝho,roughPepvearsgrew//Fillwith觠RsZhoaspirationsgggggggggghichXavyaGi,yeiewߪ___߰߰߰߰߰߱߰߮777777WW77#A`ntameatessagerombHestSucho ne'erefoPcd;GGGGGGGGGGggGGGm'lRyhadow)ȵ0soulspread` lifèIofsb໧ǼǻE8vis,futuXglory`e׼׻MoyKa kdyetnknown--'fulʆzallrophecy??roughim orse p!??wwwwwwwwwwwwwSe diAyarkyedlzeepRisenbowIheartejoice ܀vp> CHRISTIANEACE/ǼǼǼǼǼǼǼǼǽǼǺߺߺߺߺߺߺ߿ߺ߻ߺ߿77777777777777Thouhal)deYmnecretthypencerompr'غ; 6keep3laavilionG//strifeongues.font> OAndillowscewithngryoar?wwwwwwwwwwww'Tisaid,8rowneneaymmotioϒϒϒϒϒϒϒϒϓϒϒϒThatexfultnessneevermore.י///gggggggggggggF,noisefempestiwϤϣwwpsilaveshimelyששששששששתששףudeorm,owiercoe!fl//////////O///DisturbsSabb!dee1seaW___________׻׺#Soheart;knthyove,urϺϺϺϺϺϺϿϺϻϺϺϮ?here alsacredWllblblife'ngryoicesoooooooooooo nushкoits?door߾߾߾߾߾߾߾߾߾߿߾ߺawaykro`passiongggggggggggggfingousisealmdϺsoغcwellsLord,eϺϺϺϺϺϺϿߺϺϻϺϿ''''''''''''''Ͽ;O, s! 8neternal!纷׻׺span> Āvp> Aineecretf(yresencewelleth7777777777WW775wFulnessjoy--for⌡d.GGGGGGGGGGggGG?_??;mbp:pagebreak/>ABIDENENDɀaYOUwיט//THEOUL'SpSWEROOOOOOOOOOooOOǪhatysticordine,oǹ,窷%Is oourQhSdeepe//////////OO///\Wystriving,bwithongint___________/ aitackg prayxtoYe_ooooooooooo׼׻WAbidhn,Њ)IQǽWWWW____^Fromsoodour(, `veexmorenhbdiscceaswoubepaleǽifeleed:eulQo'erOL--ɑhdowyy(veWWWWWWWwWWwwWWWUEach f-medposeJdarkouh:inQuench,Yri9eselfisldesireϻϺ'xkeepyasncalm ivine. WHENWAKEAMTILLITHHEE. Dawns weetonsciousness,am!?????????ߦAlone,(i3mycm''''Tolemnushfatureewly_ײײײײײ׷ײ׸????'GGeenZthl ration?____D57Icalmewfresh2Gdswro'aceangmage'taroP0w׺׺׺׺׺׿׺׻׺׺׺So[isillthoueholdnly׺icwatermst__________׿׾_I,!oachi-YϻϺ{ʺsplenh4giveߺߺߺߺߺ߿׺ߺ߻ߺߺߝgrbedonsciousi,wakB,kday,arun(BheϺϺϺϺϺϺϺϺϺan> CHRIST'SOICENHEOULGGGGGGGGGGggGGWWWWWWWWWWwwWWU"Comeselvesaesertlrestwhile;oQ _??/w( HyomدJgo`y ixmuco߽߼'eat.CǼǻ'MidjmؚrlfifetsimnfusionIjarrdiscordspo8vanityǾǽoBth likcve roubleatersO="Bookmanldtyle"> vp> vp> FLISAFCIS(